BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= bmnc5d22
(593 letters)
Database: rice
37,544 sequences; 14,793,348 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
11_01_0347 + 2601170-2602019,2602245-2603353 27 8.5
>11_01_0347 + 2601170-2602019,2602245-2603353
Length = 652
Score = 27.5 bits (58), Expect = 8.5
Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 1/40 (2%)
Frame = -3
Query: 264 NNEWFLIA-VPVELKRFLVLYEVSRYYGAIMVEDRFMSRA 148
N W +A +P E+K + LYEV G +M D RA
Sbjct: 375 NIAWVKVAGIPDEMKGYQALYEVGSNLGPVMEIDMVTFRA 414
Database: rice
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 14,793,348
Number of sequences in database: 37,544
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,941,663
Number of Sequences: 37544
Number of extensions: 250319
Number of successful extensions: 392
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 386
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 392
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1411925004
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -