BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= bmnc5c03
(729 letters)
Database: tribolium
336 sequences; 122,585 total letters
Searching.......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 27 0.16
EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglu... 21 7.7
>AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2
protein protein.
Length = 301
Score = 27.1 bits (57), Expect = 0.16
Identities = 17/48 (35%), Positives = 23/48 (47%)
Frame = -3
Query: 274 PSAANVTSTRSPRDSRP*KPADIFAWKLFQHSENCSSDAMIATTRRGT 131
P+ A+ T T S S PA I ++ L QH CSS + +T T
Sbjct: 203 PTIASATYTNSANSSIW-SPASIDSFTLEQHRSWCSSSQPVLSTTNST 249
>EF592536-1|ABQ95982.1| 598|Tribolium castaneum
beta-N-acetylglucosaminidase NAG1 protein.
Length = 598
Score = 21.4 bits (43), Expect = 7.7
Identities = 7/13 (53%), Positives = 12/13 (92%)
Frame = -3
Query: 694 EEELFDAIDGLFG 656
+E+L+DAI+ L+G
Sbjct: 337 KEKLYDAIEALYG 349
Database: tribolium
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 122,585
Number of sequences in database: 336
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 158,516
Number of Sequences: 336
Number of extensions: 3148
Number of successful extensions: 3
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 19467635
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -