Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmnc4o08
         (157 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g32820.1 68417.m04668 expressed protein ; expression supporte...    25   6.8  
At1g65780.1 68414.m07465 tRNA-splicing endonuclease positive eff...    25   9.0  

>At4g32820.1 68417.m04668 expressed protein ; expression supported
           by MPSS
          Length = 1817

 Score = 25.0 bits (52), Expect = 6.8
 Identities = 9/13 (69%), Positives = 11/13 (84%)
 Frame = +1

Query: 73  EPQHVTIHFLGKK 111
           EPQHV + FLGK+
Sbjct: 211 EPQHVRLKFLGKR 223


>At1g65780.1 68414.m07465 tRNA-splicing endonuclease positive
           effector-related contains similarity to SEN1, a positive
           effector of tRNA-splicing endonuclease [Saccharomyces
           cerevisiae] gi|172574|gb|AAB63976
          Length = 1065

 Score = 24.6 bits (51), Expect = 9.0
 Identities = 14/41 (34%), Positives = 21/41 (51%)
 Frame = -2

Query: 138 PLERRTWKVFFAQKMYRYVLGFGINQKFYRNINL*LKTLKE 16
           PL    WK+ F+ +  +YV G   N + YR I   L+ L +
Sbjct: 860 PLNNSKWKLCFSDEFKKYV-GEIKNPETYRKIKNFLERLSQ 899


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,270,494
Number of Sequences: 28952
Number of extensions: 44716
Number of successful extensions: 87
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 86
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 87
length of database: 12,070,560
effective HSP length: 32
effective length of database: 11,144,096
effective search space used: 211737824
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)