SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmnc4m11
         (323 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr...    22   5.0  
AY146759-1|AAO12074.1|  356|Anopheles gambiae odorant-binding pr...    21   8.8  
AY062208-1|AAL58569.1|  503|Anopheles gambiae cytochrome P450 CY...    21   8.8  

>AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1
           precursor protein.
          Length = 1623

 Score = 22.2 bits (45), Expect = 5.0
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = -1

Query: 260 NRKGPILERCRE 225
           NR GP  ERC+E
Sbjct: 373 NRDGPNCERCKE 384


>AY146759-1|AAO12074.1|  356|Anopheles gambiae odorant-binding
           protein AgamOBP45 protein.
          Length = 356

 Score = 21.4 bits (43), Expect = 8.8
 Identities = 6/9 (66%), Positives = 6/9 (66%)
 Frame = +2

Query: 155 HCVTVDCCC 181
           H  T DCCC
Sbjct: 125 HADTTDCCC 133


>AY062208-1|AAL58569.1|  503|Anopheles gambiae cytochrome P450
           CYP6M1 protein.
          Length = 503

 Score = 21.4 bits (43), Expect = 8.8
 Identities = 10/44 (22%), Positives = 20/44 (45%)
 Frame = -3

Query: 132 SMLVQQRLCFLPLFPLS*NRAREPXMESXDPQCHIXQHRRPRLP 1
           S++    + F+P+F +  + +  P  E  DP+    +    R P
Sbjct: 387 SVIEAGTMLFIPIFSIQRDASLFPEPEKFDPERFSAEEEAKRHP 430


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 313,592
Number of Sequences: 2352
Number of extensions: 5925
Number of successful extensions: 5
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 563,979
effective HSP length: 56
effective length of database: 432,267
effective search space used: 22045617
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -