BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= bmnc4h01
(475 letters)
Database: tribolium
336 sequences; 122,585 total letters
Searching.......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory recept... 21 5.8
>AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory receptor
candidate 31 protein.
Length = 250
Score = 21.0 bits (42), Expect = 5.8
Identities = 9/38 (23%), Positives = 19/38 (50%)
Frame = +1
Query: 148 YEYAITFVSTLLFKNNLNLMVACNLINTLINFEINVFG 261
YE+ + ++L NN++ ++ + L I +FG
Sbjct: 146 YEHYRLYQLSVLIDNNMSYIIIVSFATNLYFIIIQLFG 183
Database: tribolium
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 122,585
Number of sequences in database: 336
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 83,848
Number of Sequences: 336
Number of extensions: 1641
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 122,585
effective HSP length: 52
effective length of database: 105,113
effective search space used: 11036865
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)
- SilkBase 1999-2023 -