SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmnc4c24
         (217 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ325094-1|ABD14108.1|  175|Apis mellifera complementary sex det...    20   3.8  
DQ325093-1|ABD14107.1|  175|Apis mellifera complementary sex det...    20   3.8  
DQ325092-1|ABD14106.1|  175|Apis mellifera complementary sex det...    20   3.8  
DQ325091-1|ABD14105.1|  175|Apis mellifera complementary sex det...    20   3.8  
DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related pro...    20   3.8  
AY569716-1|AAS86669.1|  406|Apis mellifera complementary sex det...    20   3.8  
AY569710-1|AAS86663.1|  408|Apis mellifera complementary sex det...    20   3.8  
AY569709-1|AAS86662.1|  408|Apis mellifera complementary sex det...    20   3.8  
AY569708-1|AAS86661.1|  408|Apis mellifera complementary sex det...    20   3.8  
AY569707-1|AAS86660.1|  408|Apis mellifera complementary sex det...    20   3.8  
AY569706-1|AAS86659.1|  397|Apis mellifera complementary sex det...    20   3.8  
AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9 methylt...    19   5.1  
DQ244074-1|ABB36784.1|  517|Apis mellifera cytochrome P450 monoo...    19   8.8  

>DQ325094-1|ABD14108.1|  175|Apis mellifera complementary sex
           determiner protein.
          Length = 175

 Score = 19.8 bits (39), Expect = 3.8
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +1

Query: 10  HNFYNDNRKPL 42
           +N YN+N KPL
Sbjct: 91  YNNYNNNYKPL 101


>DQ325093-1|ABD14107.1|  175|Apis mellifera complementary sex
           determiner protein.
          Length = 175

 Score = 19.8 bits (39), Expect = 3.8
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +1

Query: 10  HNFYNDNRKPL 42
           +N YN+N KPL
Sbjct: 91  YNNYNNNYKPL 101


>DQ325092-1|ABD14106.1|  175|Apis mellifera complementary sex
           determiner protein.
          Length = 175

 Score = 19.8 bits (39), Expect = 3.8
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +1

Query: 10  HNFYNDNRKPL 42
           +N YN+N KPL
Sbjct: 91  YNNYNNNYKPL 101


>DQ325091-1|ABD14105.1|  175|Apis mellifera complementary sex
           determiner protein.
          Length = 175

 Score = 19.8 bits (39), Expect = 3.8
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +1

Query: 10  HNFYNDNRKPL 42
           +N YN+N KPL
Sbjct: 91  YNNYNNNYKPL 101


>DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related
           protein STG-1 protein.
          Length = 397

 Score = 19.8 bits (39), Expect = 3.8
 Identities = 5/20 (25%), Positives = 12/20 (60%)
 Frame = -1

Query: 151 CDRARQAYFLXTSACEHMXY 92
           C+R ++ YF    + +H+ +
Sbjct: 297 CERHQKRYFFGRDSVDHVDF 316


>AY569716-1|AAS86669.1|  406|Apis mellifera complementary sex
           determiner protein.
          Length = 406

 Score = 19.8 bits (39), Expect = 3.8
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +1

Query: 10  HNFYNDNRKPL 42
           +N YN+N KPL
Sbjct: 324 YNNYNNNYKPL 334


>AY569710-1|AAS86663.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 19.8 bits (39), Expect = 3.8
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +1

Query: 10  HNFYNDNRKPL 42
           +N YN+N KPL
Sbjct: 324 YNNYNNNYKPL 334


>AY569709-1|AAS86662.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 19.8 bits (39), Expect = 3.8
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +1

Query: 10  HNFYNDNRKPL 42
           +N YN+N KPL
Sbjct: 324 YNNYNNNYKPL 334


>AY569708-1|AAS86661.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 19.8 bits (39), Expect = 3.8
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +1

Query: 10  HNFYNDNRKPL 42
           +N YN+N KPL
Sbjct: 324 YNNYNNNYKPL 334


>AY569707-1|AAS86660.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 19.8 bits (39), Expect = 3.8
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +1

Query: 10  HNFYNDNRKPL 42
           +N YN+N KPL
Sbjct: 324 YNNYNNNYKPL 334


>AY569706-1|AAS86659.1|  397|Apis mellifera complementary sex
           determiner protein.
          Length = 397

 Score = 19.8 bits (39), Expect = 3.8
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +1

Query: 10  HNFYNDNRKPL 42
           +N YN+N KPL
Sbjct: 313 YNNYNNNYKPL 323


>AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9
           methyltransferase protein.
          Length = 683

 Score = 19.4 bits (38), Expect = 5.1
 Identities = 5/7 (71%), Positives = 5/7 (71%)
 Frame = -1

Query: 31  GCRCKNC 11
           GC CK C
Sbjct: 434 GCECKTC 440


>DQ244074-1|ABB36784.1|  517|Apis mellifera cytochrome P450
           monooxygenase protein.
          Length = 517

 Score = 18.6 bits (36), Expect = 8.8
 Identities = 11/37 (29%), Positives = 16/37 (43%)
 Frame = +2

Query: 47  RXRYTMVTLKNRFTKISHMFAS*XXKKICLASTITSF 157
           R RYT + L N   +  H        ++  AST+  F
Sbjct: 140 RDRYTNLGLVNEQGQTWHDLRVALTSELTAASTVLGF 176


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.315    0.138    0.422 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 39,967
Number of Sequences: 438
Number of extensions: 568
Number of successful extensions: 13
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 146,343
effective HSP length: 46
effective length of database: 126,195
effective search space used:  3154875
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 36 (19.2 bits)

- SilkBase 1999-2023 -