SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmnc4a05
         (750 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292357-1|CAL23169.2|  355|Tribolium castaneum gustatory recept...    24   1.5  
AJ876407-1|CAI45288.1|  590|Tribolium castaneum phosphatase prot...    21   8.0  

>AM292357-1|CAL23169.2|  355|Tribolium castaneum gustatory receptor
           candidate 36 protein.
          Length = 355

 Score = 23.8 bits (49), Expect = 1.5
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 1/57 (1%)
 Frame = +2

Query: 479 YEKFVVHDVLRPFFQQDTFIFVICT-TLVRVRVFLISFDKFKTIGIRPRHYVLHRLF 646
           +EKF +   L    Q  T++ ++ T T++     + SF KF TIG+      + R+F
Sbjct: 29  FEKFSLEHQLWQKIQAWTYLILLTTWTVISASTRIKSF-KFLTIGVGITTDTIDRVF 84


>AJ876407-1|CAI45288.1|  590|Tribolium castaneum phosphatase
           protein.
          Length = 590

 Score = 21.4 bits (43), Expect = 8.0
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = -1

Query: 414 TSICAVTSVCFP 379
           TS C + SVC+P
Sbjct: 147 TSACGLFSVCYP 158


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 181,315
Number of Sequences: 336
Number of extensions: 4249
Number of successful extensions: 10
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 20027417
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -