SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmnc3p11
         (535 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY062190-1|AAL58551.1|  151|Anopheles gambiae cytochrome P450 CY...    25   2.1  
AY146753-1|AAO12068.1|  311|Anopheles gambiae odorant-binding pr...    23   6.4  
AY146750-1|AAO12065.1|  311|Anopheles gambiae odorant-binding pr...    23   6.4  

>AY062190-1|AAL58551.1|  151|Anopheles gambiae cytochrome P450
           CYP4H15 protein.
          Length = 151

 Score = 24.6 bits (51), Expect = 2.1
 Identities = 14/45 (31%), Positives = 23/45 (51%)
 Frame = -3

Query: 242 ECHKTLTPCSTHSDCNLCREGLANCQLFDEDTIVKMRGDDGQEQE 108
           E H T T C + +   L R+     +++DE  I+ + G D + QE
Sbjct: 8   EGHDTTTSCISFAAYYLSRDATVQQRVYDE--ILAIVGPDAKTQE 50


>AY146753-1|AAO12068.1|  311|Anopheles gambiae odorant-binding
           protein AgamOBP34 protein.
          Length = 311

 Score = 23.0 bits (47), Expect = 6.4
 Identities = 7/13 (53%), Positives = 8/13 (61%)
 Frame = -2

Query: 381 YCNSVHVCKLDRC 343
           YCN V  C L +C
Sbjct: 296 YCNKVKTCPLHKC 308


>AY146750-1|AAO12065.1|  311|Anopheles gambiae odorant-binding
           protein AgamOBP37 protein.
          Length = 311

 Score = 23.0 bits (47), Expect = 6.4
 Identities = 7/13 (53%), Positives = 8/13 (61%)
 Frame = -2

Query: 381 YCNSVHVCKLDRC 343
           YCN V  C L +C
Sbjct: 296 YCNKVKTCPLHKC 308


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 583,450
Number of Sequences: 2352
Number of extensions: 11769
Number of successful extensions: 13
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 563,979
effective HSP length: 60
effective length of database: 422,859
effective search space used: 49474503
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -