SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmnc3p06
         (455 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal...    27   0.24 
AJ010299-1|CAA09070.1|  722|Anopheles gambiae stat protein.            24   2.9  

>AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal
            growth factor receptorprotein.
          Length = 1433

 Score = 27.5 bits (58), Expect = 0.24
 Identities = 12/17 (70%), Positives = 12/17 (70%)
 Frame = -1

Query: 98   HQLRQHHHQPG*EQSKH 48
            HQL QHHHQP   QS H
Sbjct: 1328 HQL-QHHHQPQLSQSSH 1343


>AJ010299-1|CAA09070.1|  722|Anopheles gambiae stat protein.
          Length = 722

 Score = 23.8 bits (49), Expect = 2.9
 Identities = 16/40 (40%), Positives = 23/40 (57%)
 Frame = -3

Query: 129 AAAFKMVEIFSPVTATSSSTRMRAE*THXNSAXDTIFSXE 10
           +A  + V IF+P +  SSS+   AE +   S+ DT FS E
Sbjct: 655 SAEMRTVLIFAPSSNQSSSSTPNAEQSPSASSKDT-FSNE 693


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 328,376
Number of Sequences: 2352
Number of extensions: 5156
Number of successful extensions: 16
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 16
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16
length of database: 563,979
effective HSP length: 59
effective length of database: 425,211
effective search space used: 39119412
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -