BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= bmnc3k12
(464 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_O77393 Cluster: Putative uncharacterized protein MAL3P6... 31 9.4
>UniRef50_O77393 Cluster: Putative uncharacterized protein MAL3P6.2;
n=1; Plasmodium falciparum 3D7|Rep: Putative
uncharacterized protein MAL3P6.2 - Plasmodium falciparum
(isolate 3D7)
Length = 2423
Score = 31.5 bits (68), Expect = 9.4
Identities = 17/53 (32%), Positives = 31/53 (58%), Gaps = 3/53 (5%)
Frame = -1
Query: 362 EICQCHS*TSNLIFIFRNNEITLFLN-ILLSATRIKQYV--FFISKSHHVTYV 213
E C+ H + +F+F N L N ILL++ R + ++ F+I+++H + YV
Sbjct: 2339 EECKQHDYYKSFLFLFEQNFKILEHNIILLTSQRTQDFIKQFYINRNHFIQYV 2391
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 452,584,367
Number of Sequences: 1657284
Number of extensions: 8261321
Number of successful extensions: 14190
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 13928
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14186
length of database: 575,637,011
effective HSP length: 94
effective length of database: 419,852,315
effective search space used: 25191138900
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -