Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmnc3k12
         (464 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_O77393 Cluster: Putative uncharacterized protein MAL3P6...    31   9.4  

>UniRef50_O77393 Cluster: Putative uncharacterized protein MAL3P6.2;
            n=1; Plasmodium falciparum 3D7|Rep: Putative
            uncharacterized protein MAL3P6.2 - Plasmodium falciparum
            (isolate 3D7)
          Length = 2423

 Score = 31.5 bits (68), Expect = 9.4
 Identities = 17/53 (32%), Positives = 31/53 (58%), Gaps = 3/53 (5%)
 Frame = -1

Query: 362  EICQCHS*TSNLIFIFRNNEITLFLN-ILLSATRIKQYV--FFISKSHHVTYV 213
            E C+ H    + +F+F  N   L  N ILL++ R + ++  F+I+++H + YV
Sbjct: 2339 EECKQHDYYKSFLFLFEQNFKILEHNIILLTSQRTQDFIKQFYINRNHFIQYV 2391


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 452,584,367
Number of Sequences: 1657284
Number of extensions: 8261321
Number of successful extensions: 14190
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 13928
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14186
length of database: 575,637,011
effective HSP length: 94
effective length of database: 419,852,315
effective search space used: 25191138900
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)