SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmnc3h13
         (425 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat...    23   1.4  
AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellif...    22   3.3  
AY463910-1|AAR24352.1|  843|Apis mellifera metabotropic glutamat...    21   7.6  
AF205594-1|AAQ13840.1|  156|Apis mellifera acid phosphatase prec...    21   7.6  
AB161181-1|BAD08343.1|  933|Apis mellifera metabotropic glutamat...    21   7.6  

>AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate
           receptor protein.
          Length = 1040

 Score = 23.0 bits (47), Expect = 1.4
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -2

Query: 184 ITPYKTNYTEQCN 146
           +TPY  NYT+ C+
Sbjct: 443 VTPYNKNYTKFCS 455


>AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellifera
           ORF for hypotheticalprotein. ).
          Length = 998

 Score = 21.8 bits (44), Expect = 3.3
 Identities = 8/13 (61%), Positives = 12/13 (92%)
 Frame = +2

Query: 80  TSIPTHIDYVGQA 118
           TS+PT+I Y+G+A
Sbjct: 652 TSMPTYICYLGKA 664


>AY463910-1|AAR24352.1|  843|Apis mellifera metabotropic glutamate
           receptor 1 protein.
          Length = 843

 Score = 20.6 bits (41), Expect = 7.6
 Identities = 8/41 (19%), Positives = 17/41 (41%)
 Frame = +2

Query: 92  THIDYVGQAKAEKLYRAIITLFSIVGFVWGYIVQQFSQSVY 214
           T  DY  +      +++I  +  +    W Y+   +S+  Y
Sbjct: 110 TRFDYFARTVPPDTFQSIALVDVVKSANWSYVSTVYSEGSY 150


>AF205594-1|AAQ13840.1|  156|Apis mellifera acid phosphatase
           precursor protein.
          Length = 156

 Score = 20.6 bits (41), Expect = 7.6
 Identities = 7/10 (70%), Positives = 10/10 (100%)
 Frame = -3

Query: 420 FLLINYWIYL 391
           F+LINY+I+L
Sbjct: 16  FILINYFIFL 25


>AB161181-1|BAD08343.1|  933|Apis mellifera metabotropic glutamate
           receptor protein.
          Length = 933

 Score = 20.6 bits (41), Expect = 7.6
 Identities = 8/41 (19%), Positives = 17/41 (41%)
 Frame = +2

Query: 92  THIDYVGQAKAEKLYRAIITLFSIVGFVWGYIVQQFSQSVY 214
           T  DY  +      +++I  +  +    W Y+   +S+  Y
Sbjct: 200 TRFDYFARTVPPDTFQSIALVDVVKSANWSYVSTVYSEGSY 240


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 114,324
Number of Sequences: 438
Number of extensions: 2320
Number of successful extensions: 6
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 52
effective length of database: 123,567
effective search space used: 10997463
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

- SilkBase 1999-2023 -