SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmnc2f19
         (555 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

10_06_0105 - 10790092-10790323,10791092-10791234,10791322-107914...    35   0.050

>10_06_0105 - 10790092-10790323,10791092-10791234,10791322-10791429,
            10791796-10791903,10793133-10797686,10798347-10798461,
            10799597-10799724,10799843-10800043,10800158-10800227,
            10801233-10801314,10801433-10801556,10801761-10801778
          Length = 1960

 Score = 34.7 bits (76), Expect = 0.050
 Identities = 25/70 (35%), Positives = 37/70 (52%), Gaps = 1/70 (1%)
 Frame = +3

Query: 318  EIENDKIYKLVETVDSSNKLSRRQVDFL-IHALLNNVSVTFTLHRFVDDNVLTXDELXFL 494
            ++  DK   +VE++DSS ++ + Q D L +  LL N      L   VDD   T DE+  L
Sbjct: 1404 QVGTDKSRDIVESIDSSERVLKYQDDILQLKVLLTN------LEEQVDDLRSTKDEVEIL 1457

Query: 495  ANFLVTKLDE 524
               L +KL+E
Sbjct: 1458 NMVLKSKLEE 1467


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,508,801
Number of Sequences: 37544
Number of extensions: 158470
Number of successful extensions: 288
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 284
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 288
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1257681096
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -