BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= bmnc2e07
(707 letters)
Database: spombe
5004 sequences; 2,362,478 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
SPBC1271.06c |mug96||sequence orphan|Schizosaccharomyces pombe|c... 27 2.0
SPAC1851.04c ||SPAC27D7.01c|guanyl-nucleotide exchange factor |S... 26 4.6
>SPBC1271.06c |mug96||sequence orphan|Schizosaccharomyces pombe|chr
2|||Manual
Length = 146
Score = 27.5 bits (58), Expect = 2.0
Identities = 16/52 (30%), Positives = 29/52 (55%)
Frame = -1
Query: 176 MQSINAI*KYSLIRLCLFSINLSLY*SVSIQYSYQNLHNKEKKMLRKFIASY 21
MQ + +YSLI CL +I LS+ IQ++ +H+ ++ L+ F+ +
Sbjct: 79 MQVATCLIRYSLILTCLVAILLSVL--WRIQFAALRMHDLIEEELKMFVLQH 128
>SPAC1851.04c ||SPAC27D7.01c|guanyl-nucleotide exchange factor
|Schizosaccharomyces pombe|chr 1|||Manual
Length = 1052
Score = 26.2 bits (55), Expect = 4.6
Identities = 10/13 (76%), Positives = 12/13 (92%)
Frame = -1
Query: 341 VHFIAIYVCSKKT 303
+H +AIYVCSKKT
Sbjct: 516 LHGLAIYVCSKKT 528
Database: spombe
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 2,362,478
Number of sequences in database: 5004
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,418,110
Number of Sequences: 5004
Number of extensions: 43781
Number of successful extensions: 100
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 97
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 100
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 329179816
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -