SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmnc29b23
         (546 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    22   3.0  
AM292365-1|CAL23177.1|  313|Tribolium castaneum gustatory recept...    21   7.0  
AM292325-1|CAL23137.2|  309|Tribolium castaneum gustatory recept...    21   7.0  
AJ457831-1|CAD29886.1|  249|Tribolium castaneum helix-loop-helix...    21   9.3  
AF225975-2|AAF74116.1|  302|Tribolium castaneum Tc-tailless prot...    21   9.3  

>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 22.2 bits (45), Expect = 3.0
 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +2

Query: 410  PVPST-RLASLPNYTPPHHNDPLLEGELKECCGRVFV 517
            P P+T +  +   Y P    +P+L  E+  C GR+FV
Sbjct: 2210 PKPTTMKPTTTIGYEP---QEPVLPAEVVPCQGRLFV 2243


>AM292365-1|CAL23177.1|  313|Tribolium castaneum gustatory receptor
           candidate 44 protein.
          Length = 313

 Score = 21.0 bits (42), Expect = 7.0
 Identities = 5/11 (45%), Positives = 9/11 (81%)
 Frame = +3

Query: 114 CTVMYYLCNTL 146
           C + Y++CNT+
Sbjct: 154 CGIQYHICNTV 164


>AM292325-1|CAL23137.2|  309|Tribolium castaneum gustatory receptor
           candidate 4 protein.
          Length = 309

 Score = 21.0 bits (42), Expect = 7.0
 Identities = 5/11 (45%), Positives = 9/11 (81%)
 Frame = +3

Query: 114 CTVMYYLCNTL 146
           C + Y++CNT+
Sbjct: 150 CGIQYHICNTV 160


>AJ457831-1|CAD29886.1|  249|Tribolium castaneum helix-loop-helix
           transcription factor protein.
          Length = 249

 Score = 20.6 bits (41), Expect = 9.3
 Identities = 7/25 (28%), Positives = 14/25 (56%)
 Frame = +2

Query: 398 LPLPPVPSTRLASLPNYTPPHHNDP 472
           +P+P   ++  +S  NY+P    +P
Sbjct: 200 VPIPQRTASTASSASNYSPSQSPEP 224


>AF225975-2|AAF74116.1|  302|Tribolium castaneum Tc-tailless
           protein.
          Length = 302

 Score = 20.6 bits (41), Expect = 9.3
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +2

Query: 392 NFLPLPPVP 418
           N+LPLP VP
Sbjct: 173 NYLPLPQVP 181


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 125,252
Number of Sequences: 336
Number of extensions: 2815
Number of successful extensions: 5
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 13411456
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -