BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= bmnc28c14
(395 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_Q9TJR3 Cluster: Uncharacterized membrane protein ycf78;... 31 8.1
>UniRef50_Q9TJR3 Cluster: Uncharacterized membrane protein ycf78;
n=1; Prototheca wickerhamii|Rep: Uncharacterized
membrane protein ycf78 - Prototheca wickerhamii
Length = 586
Score = 31.1 bits (67), Expect = 8.1
Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 1/30 (3%)
Frame = -2
Query: 148 GSFHVMNGEFTFFW-WLVLKLTTFFIVHCL 62
G + + FT FW WL LK+ T+ +VH L
Sbjct: 249 GGLLLGSAAFTLFWMWLFLKIQTYILVHTL 278
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 402,607,985
Number of Sequences: 1657284
Number of extensions: 7207780
Number of successful extensions: 17635
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 17238
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 17628
length of database: 575,637,011
effective HSP length: 92
effective length of database: 423,166,883
effective search space used: 16503508437
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -