BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= bmnc27h12
(316 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 21 4.7
>DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR
protein.
Length = 381
Score = 20.6 bits (41), Expect = 4.7
Identities = 10/32 (31%), Positives = 18/32 (56%), Gaps = 1/32 (3%)
Frame = -2
Query: 246 IYSLL-MTAVFVLIDGATGVHKSPSFKKVLNY 154
IY ++ +T +F I T + K+P+ + NY
Sbjct: 46 IYMIIFVTGIFGNITTCTVIIKNPAMQTATNY 77
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 71,622
Number of Sequences: 438
Number of extensions: 1146
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 50
effective length of database: 124,443
effective search space used: 6719922
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 38 (20.3 bits)
- SilkBase 1999-2023 -