SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmnc27b07
         (630 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY736135-1|AAU84701.1|  253|Apis mellifera take-out-like carrier...    23   3.2  
EF589162-1|ABQ84439.1|  686|Apis mellifera hexamerin 70c protein.      21   7.5  
D79207-1|BAA23639.1|  432|Apis mellifera milk protein protein.         21   7.5  
AF388203-1|AAM73637.1|  432|Apis mellifera major royal jelly pro...    21   7.5  
AF000633-1|AAC61895.1|  432|Apis mellifera major royal jelly pro...    21   7.5  

>AY736135-1|AAU84701.1|  253|Apis mellifera take-out-like carrier
           protein JHBP-1 protein.
          Length = 253

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 8/18 (44%), Positives = 14/18 (77%)
 Frame = +1

Query: 136 LGQFCVIYFFLLTTSLLV 189
           +G+  +I FF+LTT L++
Sbjct: 1   MGRITIIRFFVLTTMLMM 18


>EF589162-1|ABQ84439.1|  686|Apis mellifera hexamerin 70c protein.
          Length = 686

 Score = 21.4 bits (43), Expect = 7.5
 Identities = 9/38 (23%), Positives = 20/38 (52%)
 Frame = -2

Query: 605 PIFMMLFQGTQVHMRHPLRRKPLLLEAKITARGVRYKS 492
           P F ML+Q    +     + +P   ++++   GV+++S
Sbjct: 418 PAFYMLYQNILSYFLRYKKLQPQYSQSELQMPGVKFES 455


>D79207-1|BAA23639.1|  432|Apis mellifera milk protein protein.
          Length = 432

 Score = 21.4 bits (43), Expect = 7.5
 Identities = 7/11 (63%), Positives = 10/11 (90%)
 Frame = -3

Query: 46  CFNKNRTHERH 14
           C+N++RT ERH
Sbjct: 329 CWNEHRTLERH 339


>AF388203-1|AAM73637.1|  432|Apis mellifera major royal jelly
           protein MRJP1 protein.
          Length = 432

 Score = 21.4 bits (43), Expect = 7.5
 Identities = 7/11 (63%), Positives = 10/11 (90%)
 Frame = -3

Query: 46  CFNKNRTHERH 14
           C+N++RT ERH
Sbjct: 329 CWNEHRTLERH 339


>AF000633-1|AAC61895.1|  432|Apis mellifera major royal jelly
           protein MRJP1 protein.
          Length = 432

 Score = 21.4 bits (43), Expect = 7.5
 Identities = 7/11 (63%), Positives = 10/11 (90%)
 Frame = -3

Query: 46  CFNKNRTHERH 14
           C+N++RT ERH
Sbjct: 329 CWNEHRTLERH 339


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 179,928
Number of Sequences: 438
Number of extensions: 3554
Number of successful extensions: 7
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 18826962
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -