BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= bmnc26l05
(301 letters)
Database: spombe
5004 sequences; 2,362,478 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
SPBC1734.09 |||NST UDP-N-acetylglucosamine transporter|Schizosac... 24 5.5
>SPBC1734.09 |||NST UDP-N-acetylglucosamine
transporter|Schizosaccharomyces pombe|chr 2|||Manual
Length = 316
Score = 23.8 bits (49), Expect = 5.5
Identities = 11/32 (34%), Positives = 17/32 (53%)
Frame = -1
Query: 124 AVRSHGYLSLPTARQYKCFKDGNFYWPHNGDN 29
A+ + G+L+LP+ Y CF Y+ G N
Sbjct: 217 AIHTKGFLNLPSGVWYLCFNTLAQYFCVRGVN 248
Database: spombe
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 2,362,478
Number of sequences in database: 5004
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,001,778
Number of Sequences: 5004
Number of extensions: 14862
Number of successful extensions: 26
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 25
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 26
length of database: 2,362,478
effective HSP length: 63
effective length of database: 2,047,226
effective search space used: 73700136
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -