BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= bmnc23d14
(265 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_UPI0000DA3E54 Cluster: PREDICTED: hypothetical protein;... 31 6.7
>UniRef50_UPI0000DA3E54 Cluster: PREDICTED: hypothetical protein;
n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical
protein - Rattus norvegicus
Length = 529
Score = 30.7 bits (66), Expect = 6.7
Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 1/38 (2%)
Frame = +1
Query: 40 IQSLDPSGXVFSYPPXS-VRVTVVGPP*LHISFFKIYV 150
I+S +P G FS PP +RV + GP + S F +Y+
Sbjct: 261 IESPEPRGGGFSQPPAEEIRVALQGPQVIITSIFYVYI 298
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 196,841,932
Number of Sequences: 1657284
Number of extensions: 2734821
Number of successful extensions: 4019
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3970
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4019
length of database: 575,637,011
effective HSP length: 65
effective length of database: 467,913,551
effective search space used: 10294098122
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -