Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmnc23d14
         (265 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI0000DA3E54 Cluster: PREDICTED: hypothetical protein;...    31   6.7  

>UniRef50_UPI0000DA3E54 Cluster: PREDICTED: hypothetical protein;
           n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical
           protein - Rattus norvegicus
          Length = 529

 Score = 30.7 bits (66), Expect = 6.7
 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 1/38 (2%)
 Frame = +1

Query: 40  IQSLDPSGXVFSYPPXS-VRVTVVGPP*LHISFFKIYV 150
           I+S +P G  FS PP   +RV + GP  +  S F +Y+
Sbjct: 261 IESPEPRGGGFSQPPAEEIRVALQGPQVIITSIFYVYI 298


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 196,841,932
Number of Sequences: 1657284
Number of extensions: 2734821
Number of successful extensions: 4019
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3970
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4019
length of database: 575,637,011
effective HSP length: 65
effective length of database: 467,913,551
effective search space used: 10294098122
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)