Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmnc20l01
         (685 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z50071-4|CAA90409.2| 1301|Caenorhabditis elegans Hypothetical pr...    30   1.8  

>Z50071-4|CAA90409.2| 1301|Caenorhabditis elegans Hypothetical
           protein T07D4.3 protein.
          Length = 1301

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 19/68 (27%), Positives = 31/68 (45%), Gaps = 2/68 (2%)
 Frame = +2

Query: 485 NIHTKWYEDNENKALQRMKSSLIHHLLKNLRSTGTKSTREESYKMSLIVTLPSMYHMKII 664
           N  TK  E N  K ++      +  + KNL   GT S ++ S     +  +  M+H+ I+
Sbjct: 189 NYGTKIRESNTVKTMETTAQIFVPQINKNLVGKGTGSNKKVSEAACAMNIVRQMFHLNIM 248

Query: 665 --WINPIK 682
             +  PIK
Sbjct: 249 QSYSGPIK 256


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,575,461
Number of Sequences: 27780
Number of extensions: 255025
Number of successful extensions: 552
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 535
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 552
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1560745544
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)