SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmnc20k22
         (670 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF498306-5|AAM19330.1|  456|Apis mellifera dopamine receptor typ...    27   0.21 
DQ013068-1|AAY81956.1|  931|Apis mellifera dusty protein kinase ...    22   4.6  
DQ013067-1|AAY81955.1|  969|Apis mellifera dusty protein kinase ...    22   4.6  

>AF498306-5|AAM19330.1|  456|Apis mellifera dopamine receptor type
           D2 protein.
          Length = 456

 Score = 26.6 bits (56), Expect = 0.21
 Identities = 15/51 (29%), Positives = 26/51 (50%)
 Frame = -3

Query: 605 WFSAMSLEDNNSYTNFLFNVAIKKSTTVSIAFPSPIATAPSNSSVLLFIVR 453
           ++SA     N S    L+N+A  ++    + F   +AT   N+ V+L +VR
Sbjct: 22  FYSASYPPQNRSQEEDLWNLATDRAGLAILLFLFSVATVFGNTLVILAVVR 72


>DQ013068-1|AAY81956.1|  931|Apis mellifera dusty protein kinase
           isoform B protein.
          Length = 931

 Score = 22.2 bits (45), Expect = 4.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -2

Query: 402 CHGLWRFLTLFLG 364
           C+GLWR++ L  G
Sbjct: 55  CNGLWRWIRLTYG 67


>DQ013067-1|AAY81955.1|  969|Apis mellifera dusty protein kinase
           isoform A protein.
          Length = 969

 Score = 22.2 bits (45), Expect = 4.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -2

Query: 402 CHGLWRFLTLFLG 364
           C+GLWR++ L  G
Sbjct: 93  CNGLWRWIRLTYG 105


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 173,612
Number of Sequences: 438
Number of extensions: 3622
Number of successful extensions: 5
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 20221290
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -