SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmnc20h07
         (652 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC16G5.09 |||serine carboxypeptidase |Schizosaccharomyces pomb...    23   2.5  
SPAC1527.03 |||RNA-binding protein|Schizosaccharomyces pombe|chr...    25   9.5  

>SPBC16G5.09 |||serine carboxypeptidase |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 510

 Score = 23.0 bits (47), Expect(2) = 2.5
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 562 DLVECHDWVECHD 524
           +L + HDW EC+D
Sbjct: 320 NLEKVHDWEECND 332



 Score = 22.2 bits (45), Expect(2) = 2.5
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -1

Query: 439 HDWVECHDVV 410
           HDW EC+D V
Sbjct: 325 HDWEECNDDV 334


>SPAC1527.03 |||RNA-binding protein|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 475

 Score = 25.0 bits (52), Expect = 9.5
 Identities = 12/44 (27%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = +1

Query: 88  EDIAMELESSVPA-AAQPQQNDEVLSVSCARSSAEEYQSVNTHM 216
           +++   L++S+    A+   NDE    S  +S +E+YQ  N ++
Sbjct: 37  KEVLKNLQNSLTGKTAEENLNDEANHTSSDKSKSEDYQPSNVNV 80


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.312    0.125    0.356 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,733,255
Number of Sequences: 5004
Number of extensions: 31290
Number of successful extensions: 56
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 50
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 56
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 293780908
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.9 bits)

- SilkBase 1999-2023 -