Bombyx BLAST Result against spombe

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmnc1p03
         (731 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC3F6.05 |rga1||GTPase activating protein Rga1|Schizosaccharom...    27   2.8  
SPAC1071.02 |||TFIIH regulator |Schizosaccharomyces pombe|chr 1|...    27   3.6  

>SPBC3F6.05 |rga1||GTPase activating protein
           Rga1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1150

 Score = 27.1 bits (57), Expect = 2.8
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -3

Query: 360 REGVFQNYHCPCH 322
           R GV QN+H PCH
Sbjct: 256 RNGVSQNWHVPCH 268


>SPAC1071.02 |||TFIIH regulator |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 1018

 Score = 26.6 bits (56), Expect = 3.6
 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 1/53 (1%)
 Frame = +2

Query: 95  ILFLFKEYLMLIYIVCFTFITSCDVNC-IYNEQ*SSPIYLTNELRIFIQIFFG 250
           I F F+E L  ++ +CF    S +V C IY  Q  + I   N    F + F G
Sbjct: 609 IPFFFEELLKQLFTLCFANCESMNVRCLIYVSQTINEIVRVNHFE-FQEKFVG 660


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,607,910
Number of Sequences: 5004
Number of extensions: 49398
Number of successful extensions: 76
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 73
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 76
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 345237368
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)