Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmnc1k19
         (702 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF190059-1|AAF03158.1|  152|Homo sapiens cytovillin 2 protein.         32   2.3  

>AF190059-1|AAF03158.1|  152|Homo sapiens cytovillin 2 protein.
          Length = 152

 Score = 31.9 bits (69), Expect = 2.3
 Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 1/73 (1%)
 Frame = +3

Query: 303 DFISFNATDNDNSMIIDLCSDARIIVAKKLTPDETYHQRVSGFLDFQK-RNWIPRPPIES 479
           DF+ +      N  I+ LC     +  ++  PD T  Q++      +K +N + R  +E+
Sbjct: 66  DFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTTEVQQMKAQAREEKHQNQLERQQLET 125

Query: 480 DPKVRNVLDRELE 518
           + K R  ++RE E
Sbjct: 126 EKKRREXVEREKE 138


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 82,588,147
Number of Sequences: 237096
Number of extensions: 1383971
Number of successful extensions: 2879
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2813
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2879
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8119219030
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)