Bombyx BLAST Result against fruitfly

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmnc19l16
         (204 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY180916-3|AAN87268.1|  994|Drosophila melanogaster ORF3 protein.      27   4.8  

>AY180916-3|AAN87268.1|  994|Drosophila melanogaster ORF3 protein.
          Length = 994

 Score = 26.6 bits (56), Expect = 4.8
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 4/49 (8%)
 Frame = +2

Query: 8   AQVFVIFIVVHVSTPDGGGV*IIR---HIYRFFYYKTVTKTV-KYLFIC 142
           AQ+  I    H    +GG   I R    I RF+Y+  +TKT+ KY+  C
Sbjct: 649 AQIKEILTKFHDDPIEGGHTGISRTQSKIKRFYYWPQMTKTISKYVKTC 697


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,793,099
Number of Sequences: 53049
Number of extensions: 168064
Number of successful extensions: 371
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 365
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 371
length of database: 24,988,368
effective HSP length: 47
effective length of database: 22,495,065
effective search space used: 449901300
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)