SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmnc19c05
         (352 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g01370.1 68416.m00059 expressed protein contains Pfam domain,...    30   0.38 

>At3g01370.1 68416.m00059 expressed protein contains Pfam domain,
           PF04581: Protein of unknown function (DUF578)
          Length = 1011

 Score = 30.3 bits (65), Expect = 0.38
 Identities = 18/45 (40%), Positives = 25/45 (55%)
 Frame = +1

Query: 28  PILLIKRKNYLRDNSVIFFFSSNKKKSLRPRCWIKIKFKCRSLKF 162
           P  L+ R+N  R NS IF  S++ +K+L      +I  K RSL F
Sbjct: 28  PNTLVSRRNVSRANSGIFCSSASGRKTLPQSAIQRIAEKLRSLGF 72


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 5,413,374
Number of Sequences: 28952
Number of extensions: 82390
Number of successful extensions: 113
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 113
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 113
length of database: 12,070,560
effective HSP length: 72
effective length of database: 9,986,016
effective search space used: 439384704
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -