BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= bmnc19c05
(352 letters)
Database: arabidopsis
28,952 sequences; 12,070,560 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
At3g01370.1 68416.m00059 expressed protein contains Pfam domain,... 30 0.38
>At3g01370.1 68416.m00059 expressed protein contains Pfam domain,
PF04581: Protein of unknown function (DUF578)
Length = 1011
Score = 30.3 bits (65), Expect = 0.38
Identities = 18/45 (40%), Positives = 25/45 (55%)
Frame = +1
Query: 28 PILLIKRKNYLRDNSVIFFFSSNKKKSLRPRCWIKIKFKCRSLKF 162
P L+ R+N R NS IF S++ +K+L +I K RSL F
Sbjct: 28 PNTLVSRRNVSRANSGIFCSSASGRKTLPQSAIQRIAEKLRSLGF 72
Database: arabidopsis
Posted date: Oct 4, 2007 10:56 AM
Number of letters in database: 12,070,560
Number of sequences in database: 28,952
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 5,413,374
Number of Sequences: 28952
Number of extensions: 82390
Number of successful extensions: 113
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 113
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 113
length of database: 12,070,560
effective HSP length: 72
effective length of database: 9,986,016
effective search space used: 439384704
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -