Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmnc18f23
         (697 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY569716-1|AAS86669.1|  406|Apis mellifera complementary sex det...    22   6.4  
AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    21   8.5  
AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9 methylt...    21   8.5  

>AY569716-1|AAS86669.1|  406|Apis mellifera complementary sex
           determiner protein.
          Length = 406

 Score = 21.8 bits (44), Expect = 6.4
 Identities = 11/30 (36%), Positives = 19/30 (63%)
 Frame = +2

Query: 179 NFCSYFLNHKCDAFSVILIEQIFLSHLIFC 268
           N+ +Y  N+K   +++I IEQI +   I+C
Sbjct: 323 NYNNYNNNYKPLYYNIINIEQIPVPVPIYC 352


>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
           protein.
          Length = 1370

 Score = 21.4 bits (43), Expect = 8.5
 Identities = 8/13 (61%), Positives = 10/13 (76%)
 Frame = +3

Query: 543 ANTELPCYSLHTL 581
           +N  LP Y+LHTL
Sbjct: 376 SNAFLPLYNLHTL 388


>AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9
           methyltransferase protein.
          Length = 683

 Score = 21.4 bits (43), Expect = 8.5
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = +2

Query: 188 SYFLNHKCD 214
           S+F+NH CD
Sbjct: 575 SHFINHSCD 583


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 182,820
Number of Sequences: 438
Number of extensions: 4213
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 21317625
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)