SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmnc16h17
         (717 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY736135-1|AAU84701.1|  253|Apis mellifera take-out-like carrier...    23   3.8  
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              22   6.7  
D79207-1|BAA23639.1|  432|Apis mellifera milk protein protein.         21   8.8  
AF388203-1|AAM73637.1|  432|Apis mellifera major royal jelly pro...    21   8.8  
AF000633-1|AAC61895.1|  432|Apis mellifera major royal jelly pro...    21   8.8  

>AY736135-1|AAU84701.1|  253|Apis mellifera take-out-like carrier
           protein JHBP-1 protein.
          Length = 253

 Score = 22.6 bits (46), Expect = 3.8
 Identities = 8/18 (44%), Positives = 14/18 (77%)
 Frame = +2

Query: 137 LGQFCVIYFFLLTTSLLV 190
           +G+  +I FF+LTT L++
Sbjct: 1   MGRITIIRFFVLTTMLMM 18


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 21.8 bits (44), Expect = 6.7
 Identities = 11/43 (25%), Positives = 14/43 (32%)
 Frame = -3

Query: 646  RRPSADQHCYTHPPIFHDAVPGYSGAHASPPSTETVAAGGKNN 518
            R  + +  CY      HD V      HA P S +        N
Sbjct: 1338 RTDAGEYSCYVENTFGHDTVTHQLIVHAPPHSPQITLTATTTN 1380


>D79207-1|BAA23639.1|  432|Apis mellifera milk protein protein.
          Length = 432

 Score = 21.4 bits (43), Expect = 8.8
 Identities = 7/11 (63%), Positives = 10/11 (90%)
 Frame = -2

Query: 47  CFNKNRTHERH 15
           C+N++RT ERH
Sbjct: 329 CWNEHRTLERH 339


>AF388203-1|AAM73637.1|  432|Apis mellifera major royal jelly
           protein MRJP1 protein.
          Length = 432

 Score = 21.4 bits (43), Expect = 8.8
 Identities = 7/11 (63%), Positives = 10/11 (90%)
 Frame = -2

Query: 47  CFNKNRTHERH 15
           C+N++RT ERH
Sbjct: 329 CWNEHRTLERH 339


>AF000633-1|AAC61895.1|  432|Apis mellifera major royal jelly
           protein MRJP1 protein.
          Length = 432

 Score = 21.4 bits (43), Expect = 8.8
 Identities = 7/11 (63%), Positives = 10/11 (90%)
 Frame = -2

Query: 47  CFNKNRTHERH 15
           C+N++RT ERH
Sbjct: 329 CWNEHRTLERH 339


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 205,038
Number of Sequences: 438
Number of extensions: 4317
Number of successful extensions: 8
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 22170330
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -