SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmnc16h05
         (258 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related pro...    20   4.3  
EF625896-1|ABR45903.1|  683|Apis mellifera hexamerin protein.          20   5.6  
AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.      20   5.6  
AF004842-1|AAD01205.1|  598|Apis mellifera major royal jelly pro...    19   9.8  

>DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related
           protein STG-1 protein.
          Length = 397

 Score = 20.2 bits (40), Expect = 4.3
 Identities = 5/6 (83%), Positives = 5/6 (83%)
 Frame = -1

Query: 105 SFCCWC 88
           S CCWC
Sbjct: 10  SCCCWC 15


>EF625896-1|ABR45903.1|  683|Apis mellifera hexamerin protein.
          Length = 683

 Score = 19.8 bits (39), Expect = 5.6
 Identities = 13/47 (27%), Positives = 22/47 (46%), Gaps = 1/47 (2%)
 Frame = +1

Query: 106 STVDYEL*KKKINS-YLFK*ILMNINLNYRAKFVVKTYVYFINNYSF 243
           + +DY L        YL K  +    LNY  + V   + YF+ N+++
Sbjct: 193 NNIDYYLLAANYTGWYLTKHNVPEQRLNYFTEDVGLNHFYFMLNHNY 239


>AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.
          Length = 683

 Score = 19.8 bits (39), Expect = 5.6
 Identities = 13/47 (27%), Positives = 22/47 (46%), Gaps = 1/47 (2%)
 Frame = +1

Query: 106 STVDYEL*KKKINS-YLFK*ILMNINLNYRAKFVVKTYVYFINNYSF 243
           + +DY L        YL K  +    LNY  + V   + YF+ N+++
Sbjct: 193 NNIDYYLLAANYTGWYLTKHNVPEQRLNYFTEDVGLNHFYFMLNHNY 239


>AF004842-1|AAD01205.1|  598|Apis mellifera major royal jelly
           protein MRJP5 protein.
          Length = 598

 Score = 19.0 bits (37), Expect = 9.8
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -1

Query: 66  FVLRNNSFFFCW 31
           F L NNS   CW
Sbjct: 320 FGLMNNSAIGCW 331


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 56,866
Number of Sequences: 438
Number of extensions: 1090
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 48
effective length of database: 125,319
effective search space used:  4636803
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 37 (19.9 bits)

- SilkBase 1999-2023 -