Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmnc15k14
         (542 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY898652-1|AAX83121.1|  349|Apis mellifera AKH receptor protein.       23   2.0  
DQ011226-1|AAY63895.1|  471|Apis mellifera Rh-like protein protein.    21   6.1  
DQ667192-1|ABG75744.1|  489|Apis mellifera pH-sensitive chloride...    21   8.1  
DQ667191-1|ABG75743.1|  475|Apis mellifera pH-sensitive chloride...    21   8.1  
DQ667190-1|ABG75742.1|  509|Apis mellifera pH-sensitive chloride...    21   8.1  
DQ667189-1|ABG75741.1|  458|Apis mellifera pH-sensitive chloride...    21   8.1  

>AY898652-1|AAX83121.1|  349|Apis mellifera AKH receptor protein.
          Length = 349

 Score = 23.0 bits (47), Expect = 2.0
 Identities = 11/27 (40%), Positives = 13/27 (48%)
 Frame = -1

Query: 233 IQNTTFLYRTTTSTQTRIKYWTFALRD 153
           IQ   FL+  T S    I Y  F +RD
Sbjct: 297 IQKGLFLFACTNSCMNPIVYGAFNIRD 323


>DQ011226-1|AAY63895.1|  471|Apis mellifera Rh-like protein protein.
          Length = 471

 Score = 21.4 bits (43), Expect = 6.1
 Identities = 10/46 (21%), Positives = 20/46 (43%)
 Frame = -2

Query: 460 D*QSRLVELYTFVCKKASSQWSTCCRKEKASRILMTHVAQTSLSGG 323
           D Q  ++     +       ++T     K S+  M H+  ++L+GG
Sbjct: 236 DQQRAIINTLLSISASCVIAFATSALVSKDSKFNMVHIQNSTLAGG 281


>DQ667192-1|ABG75744.1|  489|Apis mellifera pH-sensitive chloride
           channel variant 4 protein.
          Length = 489

 Score = 21.0 bits (42), Expect = 8.1
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = -3

Query: 345 RRPASQVAFRPGE 307
           +RP   V +RPGE
Sbjct: 390 KRPMHNVVYRPGE 402


>DQ667191-1|ABG75743.1|  475|Apis mellifera pH-sensitive chloride
           channel variant 3 protein.
          Length = 475

 Score = 21.0 bits (42), Expect = 8.1
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = -3

Query: 345 RRPASQVAFRPGE 307
           +RP   V +RPGE
Sbjct: 359 KRPMHNVVYRPGE 371


>DQ667190-1|ABG75742.1|  509|Apis mellifera pH-sensitive chloride
           channel variant 1 protein.
          Length = 509

 Score = 21.0 bits (42), Expect = 8.1
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = -3

Query: 345 RRPASQVAFRPGE 307
           +RP   V +RPGE
Sbjct: 410 KRPMHNVVYRPGE 422


>DQ667189-1|ABG75741.1|  458|Apis mellifera pH-sensitive chloride
           channel protein.
          Length = 458

 Score = 21.0 bits (42), Expect = 8.1
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = -3

Query: 345 RRPASQVAFRPGE 307
           +RP   V +RPGE
Sbjct: 359 KRPMHNVVYRPGE 371


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 143,920
Number of Sequences: 438
Number of extensions: 2877
Number of successful extensions: 7
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 15459066
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)