SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmnc14h19
         (224 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ232888-1|ABB36783.1|  499|Apis mellifera cytochrome P450 monoo...    21   2.5  
DQ667181-1|ABG75733.1|  445|Apis mellifera GABA-gated chloride c...    19   5.7  

>DQ232888-1|ABB36783.1|  499|Apis mellifera cytochrome P450
           monooxygenase protein.
          Length = 499

 Score = 20.6 bits (41), Expect = 2.5
 Identities = 9/32 (28%), Positives = 15/32 (46%)
 Frame = +3

Query: 120 LRYVLGDEQPVRFVAKDIASSLKYVNCERAIR 215
           L YV+ D     F  + +  ++KY N    +R
Sbjct: 236 LGYVMPDRTFAPFFTRVVTDTIKYRNDNNIVR 267


>DQ667181-1|ABG75733.1|  445|Apis mellifera GABA-gated chloride
           channel protein.
          Length = 445

 Score = 19.4 bits (38), Expect = 5.7
 Identities = 8/15 (53%), Positives = 9/15 (60%)
 Frame = +2

Query: 167 GHRQQFKICKL*TGN 211
           GHRQ+     L TGN
Sbjct: 192 GHRQRHSTIHLSTGN 206


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 49,559
Number of Sequences: 438
Number of extensions: 700
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 46
effective length of database: 126,195
effective search space used:  3533460
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 36 (19.4 bits)

- SilkBase 1999-2023 -