SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmnc14f21
         (291 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ304412-1|CAC39105.1|  196|Anopheles gambiae dynamin protein.         23   1.8  
AY028784-1|AAK32958.2|  499|Anopheles gambiae cytochrome P450 pr...    23   2.3  
AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi...    22   5.4  
AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein.           21   7.1  
AJ970246-1|CAI96718.1|  132|Anopheles gambiae putative reverse t...    21   9.4  

>AJ304412-1|CAC39105.1|  196|Anopheles gambiae dynamin protein.
          Length = 196

 Score = 23.4 bits (48), Expect = 1.8
 Identities = 11/51 (21%), Positives = 23/51 (45%)
 Frame = +2

Query: 86  TRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFG 238
           T+ F+   LLA      D     + +  + + RE++ +MY    + + + G
Sbjct: 132 TKDFINGELLAHLYATGDQASMMEESADEAQKREEMLRMYHACKEALRIIG 182


>AY028784-1|AAK32958.2|  499|Anopheles gambiae cytochrome P450
           protein.
          Length = 499

 Score = 23.0 bits (47), Expect = 2.3
 Identities = 12/30 (40%), Positives = 16/30 (53%)
 Frame = +2

Query: 155 KPTVSKTEIREKLAKMYKVTPDVVFVFGFK 244
           KPT+    I EKL K  K   D V ++ F+
Sbjct: 49  KPTIHFAYIIEKLYKRLKSKGDYVGIYFFR 78


>AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA
           topoisomerase protein.
          Length = 1039

 Score = 21.8 bits (44), Expect = 5.4
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -2

Query: 155 FLDVRHRKPSACA 117
           FL   H+KP+AC+
Sbjct: 444 FLQQHHQKPNACS 456


>AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein.
          Length = 1459

 Score = 21.4 bits (43), Expect = 7.1
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = -2

Query: 140  HRKPSACAPTI 108
            HR P+ CAP +
Sbjct: 1376 HRSPNGCAPNL 1386


>AJ970246-1|CAI96718.1|  132|Anopheles gambiae putative reverse
           transcriptase protein.
          Length = 132

 Score = 21.0 bits (42), Expect = 9.4
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = -2

Query: 224 LHRE*PCTFWRAS 186
           L R  PC FWR++
Sbjct: 118 LSRSIPCFFWRSA 130


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 304,081
Number of Sequences: 2352
Number of extensions: 5222
Number of successful extensions: 8
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 563,979
effective HSP length: 55
effective length of database: 434,619
effective search space used: 17819379
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -