BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= bmnc13d22
(567 letters)
Database: celegans
27,780 sequences; 12,740,198 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF039047-13|AAM15587.1| 402|Caenorhabditis elegans Coexpressed ... 27 7.1
>AF039047-13|AAM15587.1| 402|Caenorhabditis elegans Coexpressed
with polycystins protein4 protein.
Length = 402
Score = 27.5 bits (58), Expect = 7.1
Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 6/56 (10%)
Frame = +2
Query: 68 LFRIFK-TNTISKINYRCTSRVVP----ILNNYKSNSD-DNQSSYFRCILGATIGF 217
+F IF N I+K+N +CTS +P L Y+ S+ D S+F GA+ +
Sbjct: 9 VFLIFNLVNNINKVNSQCTSDTIPSSLATLTQYQVGSEGDPYYSHFLVNGGASFSY 64
Database: celegans
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 12,740,198
Number of sequences in database: 27,780
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,560,222
Number of Sequences: 27780
Number of extensions: 221394
Number of successful extensions: 512
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 503
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 512
length of database: 12,740,198
effective HSP length: 77
effective length of database: 10,601,138
effective search space used: 1176726318
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -