BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= bmnc12b15
(655 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 21 7.9
AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 21 7.9
AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 21 7.9
AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 21 7.9
>DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel
protein.
Length = 489
Score = 21.4 bits (43), Expect = 7.9
Identities = 14/37 (37%), Positives = 18/37 (48%)
Frame = +1
Query: 418 VVTTFHRVGENEWLLPVTGIQEASRLSGHIKVPNGVR 528
V TF +N +L VT + RLSG V G+R
Sbjct: 118 VPDTFFANDKNSFLHDVTERNKLVRLSGDGSVTYGMR 154
>AF388659-3|AAK71993.1| 548|Apis mellifera
1D-myo-inositol-trisphosphate 3-kinaseisoform C protein.
Length = 548
Score = 21.4 bits (43), Expect = 7.9
Identities = 6/13 (46%), Positives = 9/13 (69%)
Frame = +3
Query: 546 QHVCLRDCAIAVR 584
+H C+ DC + VR
Sbjct: 340 EHPCVMDCKVGVR 352
>AF388659-2|AAK71994.1| 463|Apis mellifera
1D-myo-inositol-trisphosphate 3-kinaseisoform B protein.
Length = 463
Score = 21.4 bits (43), Expect = 7.9
Identities = 6/13 (46%), Positives = 9/13 (69%)
Frame = +3
Query: 546 QHVCLRDCAIAVR 584
+H C+ DC + VR
Sbjct: 255 EHPCVMDCKVGVR 267
>AF388659-1|AAK71995.1| 782|Apis mellifera
1D-myo-inositol-trisphosphate 3-kinaseisoform A protein.
Length = 782
Score = 21.4 bits (43), Expect = 7.9
Identities = 6/13 (46%), Positives = 9/13 (69%)
Frame = +3
Query: 546 QHVCLRDCAIAVR 584
+H C+ DC + VR
Sbjct: 574 EHPCVMDCKVGVR 586
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 182,323
Number of Sequences: 438
Number of extensions: 3656
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19804986
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -