BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= bmnc11l12
(632 letters)
Database: fruitfly
53,049 sequences; 24,988,368 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AE014297-1930|AAF55127.2| 1363|Drosophila melanogaster CG31304-P... 29 6.9
>AE014297-1930|AAF55127.2| 1363|Drosophila melanogaster CG31304-PA
protein.
Length = 1363
Score = 28.7 bits (61), Expect = 6.9
Identities = 14/41 (34%), Positives = 24/41 (58%)
Frame = +1
Query: 187 VDLWIQKCLMMVPHTQEKNPDQNLVLGPAAYHILPPSPDLE 309
+D ++Q+ +M+ P TQ+ P + L I+PP P+LE
Sbjct: 937 LDSFLQQ-IMVAPPTQKATPAKELTPEEIMSFIIPPPPNLE 976
Database: fruitfly
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 24,988,368
Number of sequences in database: 53,049
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,439,913
Number of Sequences: 53049
Number of extensions: 456364
Number of successful extensions: 1167
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1152
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1167
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2641708800
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -