Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmnc11h19
         (218 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF069739-1|AAC63272.2|  690|Apis mellifera translation initiatio...    20   3.0  
DQ869051-1|ABJ09598.1|  581|Apis mellifera pyrokinin-like recept...    19   5.3  
DQ244075-1|ABB36785.1|  548|Apis mellifera cytochrome P450 monoo...    19   6.9  
AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr...    19   6.9  
AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    19   9.2  
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    19   9.2  

>AF069739-1|AAC63272.2|  690|Apis mellifera translation initiation
           factor 2 protein.
          Length = 690

 Score = 20.2 bits (40), Expect = 3.0
 Identities = 7/28 (25%), Positives = 17/28 (60%)
 Frame = +3

Query: 96  EKMRIETQKKDILRQTVEN*KKRLRPHP 179
           +K++   + KDI ++ + N  + ++ HP
Sbjct: 119 KKIKKTMENKDITKRPLPNESQLIKRHP 146


>DQ869051-1|ABJ09598.1|  581|Apis mellifera pyrokinin-like receptor
           2 protein.
          Length = 581

 Score = 19.4 bits (38), Expect = 5.3
 Identities = 11/34 (32%), Positives = 18/34 (52%)
 Frame = +3

Query: 96  EKMRIETQKKDILRQTVEN*KKRLRPHPHASS*F 197
           EK+R+ET++    +Q  +N   +L   P   S F
Sbjct: 505 EKLRLETKELFSSQQKTKNNLMKLETTPVLPSRF 538


>DQ244075-1|ABB36785.1|  548|Apis mellifera cytochrome P450
           monooxygenase protein.
          Length = 548

 Score = 19.0 bits (37), Expect = 6.9
 Identities = 6/13 (46%), Positives = 10/13 (76%)
 Frame = -1

Query: 188 TSVWMRP*PLFSV 150
           T +W+RP  LF++
Sbjct: 225 TKIWLRPDWLFNL 237


>AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein
           protein.
          Length = 1308

 Score = 19.0 bits (37), Expect = 6.9
 Identities = 6/8 (75%), Positives = 6/8 (75%)
 Frame = +1

Query: 19  AWAGTGRD 42
           AW G GRD
Sbjct: 484 AWIGAGRD 491


>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
            AbsCAM-Ig7B protein.
          Length = 1923

 Score = 18.6 bits (36), Expect = 9.2
 Identities = 7/13 (53%), Positives = 8/13 (61%)
 Frame = +3

Query: 21   VGRYWQGSGLLPC 59
            V R W+GS  L C
Sbjct: 1323 VVRPWRGSATLAC 1335


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
            AbsCAM-Ig7A protein.
          Length = 1919

 Score = 18.6 bits (36), Expect = 9.2
 Identities = 7/13 (53%), Positives = 8/13 (61%)
 Frame = +3

Query: 21   VGRYWQGSGLLPC 59
            V R W+GS  L C
Sbjct: 1319 VVRPWRGSATLAC 1331


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 44,302
Number of Sequences: 438
Number of extensions: 498
Number of successful extensions: 6
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 46
effective length of database: 126,195
effective search space used:  3281070
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 36 (19.4 bits)