BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10o01 (687 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY752897-1|AAV30071.1| 107|Anopheles gambiae peroxidase 4B prot... 26 1.3 AF364131-1|AAL35507.1| 378|Anopheles gambiae putative odorant r... 24 5.2 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 9.0 >AY752897-1|AAV30071.1| 107|Anopheles gambiae peroxidase 4B protein. Length = 107 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +1 Query: 382 DVLENVTLSVAGRVHSIRESGA 447 D +++V L+VAG + S RE+GA Sbjct: 56 DTVDDVELAVAGALESHREAGA 77 >AF364131-1|AAL35507.1| 378|Anopheles gambiae putative odorant receptor Or2 protein. Length = 378 Score = 23.8 bits (49), Expect = 5.2 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = -3 Query: 214 MVSFQRQRPAVVKLFRPSPLTFLQLSTFVSVRFSKF 107 ++ + QRP V+K+ P+T ++V +S F Sbjct: 335 LIIARAQRPMVIKVGNVYPMTLEMFQKLLNVSYSYF 370 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.0 bits (47), Expect = 9.0 Identities = 12/37 (32%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +1 Query: 442 GAKLIF-YDLRAEGAKIQVMANAKLYETEDKFFKDTD 549 G K+++ YD+RAE QV A + +E + +D + Sbjct: 2545 GRKILYQYDVRAERTFKQVRAKDETVLSEKYYIRDAN 2581 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 608,955 Number of Sequences: 2352 Number of extensions: 10041 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -