BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10n16 (618 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 23 2.1 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 23 2.7 EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 21 6.3 EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 21 8.3 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 23.0 bits (47), Expect = 2.1 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +2 Query: 203 PFRWCISRKGHRPRES 250 PF+W +K R RES Sbjct: 323 PFKWLFKKKKRRNRES 338 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 22.6 bits (46), Expect = 2.7 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +3 Query: 411 GHAVGDIPGVR 443 G AVGD+PG+R Sbjct: 62 GTAVGDVPGLR 72 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 21.4 bits (43), Expect = 6.3 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = -1 Query: 525 CTPMILVAPFSLCRERGET 469 C P + V P C E G T Sbjct: 163 CDPAVCVLPDCFCSEDGTT 181 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 21.0 bits (42), Expect = 8.3 Identities = 12/52 (23%), Positives = 21/52 (40%) Frame = -2 Query: 158 VRPSLFTTVVHVLTRRSYSSGFTHLDSTTPIGYGWEKKLIGLAIGQPLASSL 3 + P+L T +++ S HL+ + G KK L + P +L Sbjct: 44 IDPTLCTHLIYSFVGLGDDSRIKHLEPNLDVNQGNLKKFNALKLKNPNLKTL 95 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,932 Number of Sequences: 336 Number of extensions: 3424 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15770591 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -