BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10n07 (341 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein pro... 21 5.4 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 21 5.4 AB208107-1|BAE72139.1| 71|Apis mellifera Broad complex zinc fi... 21 5.4 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 20 9.5 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 20 9.5 >L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein protein. Length = 69 Score = 20.6 bits (41), Expect = 5.4 Identities = 11/42 (26%), Positives = 21/42 (50%) Frame = -1 Query: 215 N*SLVPFHVSCH*IIDKMLFRCATCGYVSVIL*NLNRNISAY 90 N S++ H+ H + + +RCA C Y + +L ++ Y Sbjct: 28 NKSMLNSHLKSHSNVYQ--YRCANCTYATKYCHSLKLHLRKY 67 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 20.6 bits (41), Expect = 5.4 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 92 KLIYFDLNFTR*QKHSHTSHN 154 KL+ FDLN ++ K HN Sbjct: 157 KLLAFDLNTSKLLKQIEIPHN 177 >AB208107-1|BAE72139.1| 71|Apis mellifera Broad complex zinc finger domain-Z2 isoform protein. Length = 71 Score = 20.6 bits (41), Expect = 5.4 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 167 KMLFRCATCGYVSVIL*NLNRNIS 96 K LF C CG V +L R+++ Sbjct: 3 KKLFTCQLCGKVLCSKASLKRHVA 26 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 19.8 bits (39), Expect = 9.5 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -1 Query: 320 INFILNLMYKFNSN 279 IN +LN++Y N N Sbjct: 75 INDVLNVLYFINKN 88 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 19.8 bits (39), Expect = 9.5 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +2 Query: 26 IPSPSAELEPSAVDYAD 76 + SPSA L+P V Y + Sbjct: 96 VGSPSAALQPQHVVYGN 112 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,925 Number of Sequences: 438 Number of extensions: 1587 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 7839909 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -