BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10n06 (736 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11654| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_54209| Best HMM Match : Baculo_11_kDa (HMM E-Value=8) 28 6.8 SB_39175| Best HMM Match : DUF1378 (HMM E-Value=8) 28 6.8 SB_39546| Best HMM Match : FCH (HMM E-Value=8e-13) 28 6.8 SB_26266| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 28 6.8 >SB_11654| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1161 Score = 28.7 bits (61), Expect = 5.2 Identities = 20/82 (24%), Positives = 41/82 (50%) Frame = -3 Query: 431 SVTITWIVLS*TLPKKSNTLTVSILFNLILVSLACIGSNRLRAPTD*VDKIFKLSVLLGV 252 S+ + W+VL+ +L TV+ +F ++++ + L D K+ +L V Sbjct: 904 SLGLIWVVLNFSLKGNEKAYTVATIFGVVIIIFRFL---TLSGKHD----TLKMLMLTVV 956 Query: 251 MSLINNDAAV*EAVVLMVCNMS 186 MSL+ + + V+LM+ ++S Sbjct: 957 MSLVKSFFTIAVLVILMIVDIS 978 >SB_54209| Best HMM Match : Baculo_11_kDa (HMM E-Value=8) Length = 337 Score = 28.3 bits (60), Expect = 6.8 Identities = 21/78 (26%), Positives = 39/78 (50%) Frame = -2 Query: 483 ISKYNAIALIVTDDAHLLCNYHLDRVVVNAPQKV*HVDRFDSIQLNFGLVGLHRFQQIAR 304 ++ + + AL T A C H ++ A ++ + R +++ +N L + + QQIAR Sbjct: 107 LTNWTSAALRFTKHAQGNCEIHKFSMI--AIEEFKKIMRTEAVPINLQLNNIVQ-QQIAR 163 Query: 303 SDRLSRQNF*TFSFIGRN 250 + + R F T F G+N Sbjct: 164 NREILRSLFKTIIFCGKN 181 >SB_39175| Best HMM Match : DUF1378 (HMM E-Value=8) Length = 282 Score = 28.3 bits (60), Expect = 6.8 Identities = 16/27 (59%), Positives = 18/27 (66%), Gaps = 2/27 (7%) Frame = +3 Query: 645 ITTLP*RLSTRRE--TRASSSQRQRPP 719 ITT+P RL+ RRE TRASS PP Sbjct: 145 ITTIPSRLTYRREDNTRASSQCSAHPP 171 >SB_39546| Best HMM Match : FCH (HMM E-Value=8e-13) Length = 360 Score = 28.3 bits (60), Expect = 6.8 Identities = 15/55 (27%), Positives = 28/55 (50%) Frame = +1 Query: 205 NTTASQTAASLLINDITPNKTESLKILSTQSVGARNLLEPMQANETKIKLNRIET 369 NT+ + A L++ND+T K + L TQ + + + + KI+ + +ET Sbjct: 296 NTSTNLKANKLMVNDLTGEKLQHKNTLLTQELQIIDQQLEHKIRDLKIEKDNLET 350 >SB_26266| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1038 Score = 28.3 bits (60), Expect = 6.8 Identities = 15/55 (27%), Positives = 28/55 (50%) Frame = +1 Query: 205 NTTASQTAASLLINDITPNKTESLKILSTQSVGARNLLEPMQANETKIKLNRIET 369 NT+ + A L++ND+T K + L TQ + + + + KI+ + +ET Sbjct: 244 NTSTNLKANKLMVNDLTGEKLQHKNTLLTQELQIIDQQLEHKIRDLKIEKDNLET 298 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,171,992 Number of Sequences: 59808 Number of extensions: 424590 Number of successful extensions: 1095 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1012 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1095 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1974037988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -