BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10n06 (736 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g41560.1 68415.m05136 calcium-transporting ATPase 4, plasma m... 30 1.4 At3g57330.1 68416.m06381 calcium-transporting ATPase, plasma mem... 29 2.4 At1g16400.1 68414.m01961 cytochrome P450 family protein similar ... 28 7.4 At3g58760.1 68416.m06549 ankyrin protein kinase, putative simila... 27 9.8 At1g16410.2 68414.m01962 cytochrome P450, putative similar to gb... 27 9.8 At1g16410.1 68414.m01963 cytochrome P450, putative similar to gb... 27 9.8 >At2g41560.1 68415.m05136 calcium-transporting ATPase 4, plasma membrane-type / Ca2+-ATPase, isoform 4 (ACA4) identical to SP|O22218 Calcium-transporting ATPase 4, plasma membrane-type (EC 3.6.3.8) (Ca(2+)-ATPase isoform 4) {Arabidopsis thaliana} Length = 1030 Score = 30.3 bits (65), Expect = 1.4 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = -3 Query: 212 VVLMVCNMSTAAICVCAEGFAGGXXXXXXRVCDMLLPVSISSIS 81 ++LMVC + + + V EGF G + +LL V +++IS Sbjct: 172 IILMVCAVVSIGVGVATEGFPRGMYDGTGILLSILLVVMVTAIS 215 >At3g57330.1 68416.m06381 calcium-transporting ATPase, plasma membrane-type, putative / Ca2+-ATPase, putative (ACA11) identical to SP|Q9M2L4|ACAB_ARATH Potential calcium-transporting ATPase 11, plasma membrane-type (EC 3.6.3.8) (Ca(2+)-ATPase isoform 11) {Arabidopsis thaliana}; strong similarity to calmodulin-stimulated calcium-ATPase [Brassica oleracea] GI:1805654 Length = 1025 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = -3 Query: 212 VVLMVCNMSTAAICVCAEGFAGGXXXXXXRVCDMLLPVSISSIS 81 ++LMVC + + + V EGF G + ++L V +++IS Sbjct: 172 IILMVCAVVSIGVGVATEGFPKGMYDGTGILLSIILVVMVTAIS 215 >At1g16400.1 68414.m01961 cytochrome P450 family protein similar to gb|AF069494 cytochrome P450 from Sinapis alba and is a member of the PF|00067 Cytochrome P450 family; identical to cytochrome P450 CYP79F2 (CYP79F2) GI:10946207 Length = 537 Score = 27.9 bits (59), Expect = 7.4 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = +1 Query: 361 IETVNVLDFLGSVYDNTIQVIVTE*VCVVGHDERYRVVFGNKQIAVKN 504 IE N++ ++ S+Y + V V E V G+ R++FG + + +N Sbjct: 165 IEADNLIAYIHSMYQRSETVDVRELSRVYGYAVTMRMLFGRRHVTKEN 212 >At3g58760.1 68416.m06549 ankyrin protein kinase, putative similar to ankyrin-kinase [Medicago truncatula] gi|18700701|gb|AAL78674 Length = 471 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +1 Query: 352 LNRIETVNVLDFLGSVYDNTIQVIVTE 432 L +I NV+ FLG+V +T +IVTE Sbjct: 213 LQKIRHPNVVQFLGAVTQSTPMMIVTE 239 >At1g16410.2 68414.m01962 cytochrome P450, putative similar to gb|AF069494 cytochrome P450 from Sinapis alba and is a member of the PF|00067 Cytochrome P450 family Length = 423 Score = 27.5 bits (58), Expect = 9.8 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = +1 Query: 361 IETVNVLDFLGSVYDNTIQVIVTE*VCVVGHDERYRVVFGNKQIAVKN 504 IE N++ ++ S+Y + V V E V G+ R++FG + + +N Sbjct: 166 IEADNLIAYVHSMYQRSETVDVRELSRVYGYAVTMRMLFGRRHVTKEN 213 >At1g16410.1 68414.m01963 cytochrome P450, putative similar to gb|AF069494 cytochrome P450 from Sinapis alba and is a member of the PF|00067 Cytochrome P450 family Length = 538 Score = 27.5 bits (58), Expect = 9.8 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = +1 Query: 361 IETVNVLDFLGSVYDNTIQVIVTE*VCVVGHDERYRVVFGNKQIAVKN 504 IE N++ ++ S+Y + V V E V G+ R++FG + + +N Sbjct: 166 IEADNLIAYVHSMYQRSETVDVRELSRVYGYAVTMRMLFGRRHVTKEN 213 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,430,064 Number of Sequences: 28952 Number of extensions: 279081 Number of successful extensions: 726 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 715 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 726 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1614253080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -