BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10n05 (299 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L36067-1|AAA29362.1| 229|Anopheles gambiae polyubiquitin protein. 129 2e-32 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 31 0.007 AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein p... 27 0.20 DQ013245-1|AAY34441.1| 487|Anopheles gambiae adrenodoxin reduct... 24 1.4 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 23 1.9 AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical prot... 22 4.3 AY330183-1|AAQ16289.1| 190|Anopheles gambiae odorant-binding pr... 21 7.6 AJ618925-1|CAF02004.1| 204|Anopheles gambiae odorant-binding pr... 21 7.6 >L36067-1|AAA29362.1| 229|Anopheles gambiae polyubiquitin protein. Length = 229 Score = 129 bits (312), Expect = 2e-32 Identities = 58/76 (76%), Positives = 69/76 (90%) Frame = +3 Query: 18 MQIFIKTLTGKTITAETEPAETVADLKQKIADKEGVPVDQQRLIFAGKQLEDSKTMADYN 197 MQIF+KTLTGKTIT E EP++T+ ++K KI DKEG+P DQQRLIFAGKQLED +T++DYN Sbjct: 1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60 Query: 198 IQKESTLHMVLRLRGG 245 IQKESTLH+VLRLRGG Sbjct: 61 IQKESTLHLVLRLRGG 76 Score = 129 bits (312), Expect = 2e-32 Identities = 58/76 (76%), Positives = 69/76 (90%) Frame = +3 Query: 18 MQIFIKTLTGKTITAETEPAETVADLKQKIADKEGVPVDQQRLIFAGKQLEDSKTMADYN 197 MQIF+KTLTGKTIT E EP++T+ ++K KI DKEG+P DQQRLIFAGKQLED +T++DYN Sbjct: 77 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136 Query: 198 IQKESTLHMVLRLRGG 245 IQKESTLH+VLRLRGG Sbjct: 137 IQKESTLHLVLRLRGG 152 Score = 129 bits (312), Expect = 2e-32 Identities = 58/76 (76%), Positives = 69/76 (90%) Frame = +3 Query: 18 MQIFIKTLTGKTITAETEPAETVADLKQKIADKEGVPVDQQRLIFAGKQLEDSKTMADYN 197 MQIF+KTLTGKTIT E EP++T+ ++K KI DKEG+P DQQRLIFAGKQLED +T++DYN Sbjct: 153 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212 Query: 198 IQKESTLHMVLRLRGG 245 IQKESTLH+VLRLRGG Sbjct: 213 IQKESTLHLVLRLRGG 228 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 31.5 bits (68), Expect = 0.007 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 1/62 (1%) Frame = +1 Query: 25 YSSKH*RAKPLPP-KRNPQRRWPISSKKLPIKKVCP*INKDLSLRANNWKIPKLWPITIF 201 Y + H + +PP +RNP+RR P S + P + P + S R +W P+ P + Sbjct: 240 YKNAHASIRKIPPSRRNPRRRSPRSGGRWPSCRSPPARRRSRSTRPTSW--PRSRPTSKP 297 Query: 202 KR 207 KR Sbjct: 298 KR 299 >AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein protein. Length = 499 Score = 26.6 bits (56), Expect = 0.20 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = +3 Query: 3 SNSVKMQIFIKTLTGKTITAETEPAETVADLKQKIADKEGVPVD-QQRLIFAGKQ 164 + +VK ++T+ + I ETE A+ DL+ +I EG V+ + F+G Q Sbjct: 339 AGNVKSLGQMETVEIRFIDEETEAADVERDLRNQITGLEGYKVEVTMKTSFSGMQ 393 >DQ013245-1|AAY34441.1| 487|Anopheles gambiae adrenodoxin reductase protein. Length = 487 Score = 23.8 bits (49), Expect = 1.4 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -1 Query: 212 RFLLNIVIGHSFGIFQLFARKDKSLLIYG 126 RFL N+ +G F + +L R LL YG Sbjct: 99 RFLGNLCLGKDFTLEELRERYHAVLLTYG 127 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 23.4 bits (48), Expect = 1.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 108 ADKEGVPVDQQRLIFAGKQLEDSKTM 185 A E PVD L+ K +ED KT+ Sbjct: 166 AQAEDYPVDLYYLMDLSKSMEDDKTI 191 >AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical protein protein. Length = 257 Score = 22.2 bits (45), Expect = 4.3 Identities = 11/29 (37%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +1 Query: 43 RAKPLPPKRNPQRRWPISSKKL-PIKKVC 126 R P+PP ++ QRR SS + + VC Sbjct: 63 RMPPVPPPKHSQRRRRSSSPRTRQFRSVC 91 >AY330183-1|AAQ16289.1| 190|Anopheles gambiae odorant-binding protein AgamOBP57 protein. Length = 190 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -1 Query: 53 GFARQCFDE 27 GF +QCFDE Sbjct: 112 GFIQQCFDE 120 >AJ618925-1|CAF02004.1| 204|Anopheles gambiae odorant-binding protein OBP14426 protein. Length = 204 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -1 Query: 53 GFARQCFDE 27 GF +QCFDE Sbjct: 126 GFIQQCFDE 134 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 289,412 Number of Sequences: 2352 Number of extensions: 5037 Number of successful extensions: 15 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 55 effective length of database: 434,619 effective search space used: 19123236 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -