Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmnc10m19
         (727 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

08_01_0104 + 745114-745584,745657-745718,745804-745910,746091-74...    29   5.0  

>08_01_0104 +
           745114-745584,745657-745718,745804-745910,746091-746186,
           746326-746375
          Length = 261

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 1/61 (1%)
 Frame = +3

Query: 279 SQLIGVSIN-FKCIESFQVRTLVLHETNVCHSYCVLFCKFKLRDFFMNQNSAYMNLNVHF 455
           S+++ V +N  K      ++     E + C   CV  CK   ++FF N+    + +N +F
Sbjct: 156 SEVVEVEVNGVKQKSGVLIKKCRYLENSGCVGMCVNMCKIPTQNFFTNEFGLPLTMNPNF 215

Query: 456 K 458
           +
Sbjct: 216 E 216


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,064,148
Number of Sequences: 37544
Number of extensions: 210380
Number of successful extensions: 289
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 288
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 289
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1898162308
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)