BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10m15 (708 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 25 0.70 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 25 0.70 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 25 0.70 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 25 0.93 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 25 0.93 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 25 0.93 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 25 0.93 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 24 1.2 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 23 2.1 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 23 3.7 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 22 6.6 S78458-1|AAB34402.1| 46|Apis mellifera apamin protein. 22 6.6 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 22 6.6 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 25.0 bits (52), Expect = 0.70 Identities = 14/55 (25%), Positives = 27/55 (49%) Frame = -1 Query: 579 QRVEIAFGFLLVKNNFV*MVNLIAVPIAIKYVVVRNFKTFAKIYYIVEFCVRVVV 415 ++V ++ L+ + F +V I P ++ ++ + FA I + CV VVV Sbjct: 274 EKVTLSISILISLHVFFLLVVEIIPPTSLVVPLLGKYLIFAMILVSISICVTVVV 328 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 25.0 bits (52), Expect = 0.70 Identities = 14/55 (25%), Positives = 27/55 (49%) Frame = -1 Query: 579 QRVEIAFGFLLVKNNFV*MVNLIAVPIAIKYVVVRNFKTFAKIYYIVEFCVRVVV 415 ++V ++ L+ + F +V I P ++ ++ + FA I + CV VVV Sbjct: 274 EKVTLSISILISLHVFFLLVVEIIPPTSLVVPLLGKYLIFAMILVSISICVTVVV 328 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 25.0 bits (52), Expect = 0.70 Identities = 9/30 (30%), Positives = 13/30 (43%) Frame = -3 Query: 475 QFQDLCKNLLHCRILRSCRCARICT*NCAC 386 +++ C L HC +C C C C C Sbjct: 738 RYEAHCFALCHCCDFDACDCEMTCPAGCKC 767 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.6 bits (51), Expect = 0.93 Identities = 9/30 (30%), Positives = 19/30 (63%) Frame = +1 Query: 385 NTHSFKYRYVHNDTNAKFYNVIDFCKGLEI 474 + +++KY Y +N+ N K Y I++ + + I Sbjct: 91 HNNNYKYNYNNNNYNKKLYYNINYIEQIPI 120 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.6 bits (51), Expect = 0.93 Identities = 9/30 (30%), Positives = 19/30 (63%) Frame = +1 Query: 385 NTHSFKYRYVHNDTNAKFYNVIDFCKGLEI 474 + +++KY Y +N+ N K Y I++ + + I Sbjct: 91 HNNNYKYNYNNNNYNKKLYYNINYIEQIPI 120 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.6 bits (51), Expect = 0.93 Identities = 9/30 (30%), Positives = 19/30 (63%) Frame = +1 Query: 385 NTHSFKYRYVHNDTNAKFYNVIDFCKGLEI 474 + +++KY Y +N+ N K Y I++ + + I Sbjct: 91 HNNNYKYNYNNNNYNKKLYYNINYIEQIPI 120 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.6 bits (51), Expect = 0.93 Identities = 9/30 (30%), Positives = 19/30 (63%) Frame = +1 Query: 385 NTHSFKYRYVHNDTNAKFYNVIDFCKGLEI 474 + +++KY Y +N+ N K Y I++ + + I Sbjct: 91 HNNNYKYNYNNNNYNKKLYYNINYIEQIPI 120 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 24.2 bits (50), Expect = 1.2 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 45 RICKIQTWTRSRCSIGRTWTGIFFVTL 125 ++ K TWT R +I +T TG F+T+ Sbjct: 487 QVIKQNTWTVFRDAITQTGTGPAFLTI 513 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 23.4 bits (48), Expect = 2.1 Identities = 15/51 (29%), Positives = 23/51 (45%) Frame = +1 Query: 514 QVYHLNEIIFHKQKSKRDLNSLGALFATKQGLLKILMRLNFDNKSNALLHL 666 Q YH+ + F KQK ++ L + L LM F NKS ++ + Sbjct: 9 QHYHITPV-FTKQKKVKEDTELNLQTIFNEDKLDNLMDKQFKNKSLPVIEI 58 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 22.6 bits (46), Expect = 3.7 Identities = 14/55 (25%), Positives = 24/55 (43%) Frame = -1 Query: 579 QRVEIAFGFLLVKNNFV*MVNLIAVPIAIKYVVVRNFKTFAKIYYIVEFCVRVVV 415 ++V ++ LL F ++ I P ++ ++ F F I CV VVV Sbjct: 270 EKVSLSISILLSLTVFFLLLAEIIPPTSLVVPLLGKFVLFTMILDTFSICVTVVV 324 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.8 bits (44), Expect = 6.6 Identities = 12/42 (28%), Positives = 17/42 (40%) Frame = +1 Query: 304 FDPDDYKKYHINVQQWSHIVKWDSFKCNTHSFKYRYVHNDTN 429 FD D Y+ N Q H K D+ N H+ + + N Sbjct: 417 FDNQDNNHYNHNHNQARHSSKSDNQNNNQHNDQAHHSSKSNN 458 >S78458-1|AAB34402.1| 46|Apis mellifera apamin protein. Length = 46 Score = 21.8 bits (44), Expect = 6.6 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -3 Query: 160 IIIAVRCAYLFVNVTKNIPVHVRPIL 83 +I +RC YLF++V V P++ Sbjct: 1 MISMLRCIYLFLSVILITSYFVTPVM 26 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 21.8 bits (44), Expect = 6.6 Identities = 13/52 (25%), Positives = 23/52 (44%) Frame = -1 Query: 570 EIAFGFLLVKNNFV*MVNLIAVPIAIKYVVVRNFKTFAKIYYIVEFCVRVVV 415 +I F L + VNLI ++I Y+ V F A + C+ +++ Sbjct: 224 DIFFNITLRRKTLFYTVNLIVPCVSISYLSVLAFYLPADSGEKIALCINILL 275 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,878 Number of Sequences: 438 Number of extensions: 3798 Number of successful extensions: 16 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21804885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -