BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10m12 (683 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g17690.1 68415.m02048 F-box family protein contains F-box dom... 33 0.18 At1g27100.1 68414.m03303 expressed protein contains Pfam profil... 31 0.94 At5g47690.1 68418.m05887 expressed protein 28 6.6 At3g30842.1 68416.m03968 ABC transporter protein, putative simil... 27 8.8 At1g08985.1 68414.m01002 expressed protein 27 8.8 >At2g17690.1 68415.m02048 F-box family protein contains F-box domain Pfam:PF00646 Length = 421 Score = 33.1 bits (72), Expect = 0.18 Identities = 15/53 (28%), Positives = 28/53 (52%), Gaps = 2/53 (3%) Frame = +2 Query: 464 GNANDSMIYLRSHLDKYLAVDSFGNVTCESEEKEPGSK--FHISVSDDNSGRW 616 GN ND ++H ++ D+ GNV+C+ E++P F + +D+ +W Sbjct: 296 GNGNDDFFAAQAHRFIHVLHDNLGNVSCKPFERDPPKTIGFKVYKNDEELLKW 348 >At1g27100.1 68414.m03303 expressed protein contains Pfam profile: PF04601 protein of unknown function (DUF569 Length = 519 Score = 30.7 bits (66), Expect = 0.94 Identities = 19/61 (31%), Positives = 29/61 (47%) Frame = +2 Query: 347 IGLINSRYRYLTAETFGFKINANGTSLKKKQIWTLEPASGNANDSMIYLRSHLDKYLAVD 526 I + NS +YLTA+ + N K WT+EP + + +I L+S KYL Sbjct: 236 IRMRNSHNKYLTADDDEETVTQNRNGSTKNARWTVEPVRDSFH--VIRLKSCYGKYLTAS 293 Query: 527 S 529 + Sbjct: 294 N 294 >At5g47690.1 68418.m05887 expressed protein Length = 1638 Score = 27.9 bits (59), Expect = 6.6 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 10/77 (12%) Frame = +2 Query: 470 ANDSMIYLRSHLDKYLAVDSFG----------NVTCESEEKEPGSKFHISVSDDNSGRWA 619 A++ ++L S +DK +++DS +++ +K SK I+ SD WA Sbjct: 1265 ASEDELHLESDMDKNVSLDSHDENSDQEKMLESISPRKRKKSLSSKLKITESD-----WA 1319 Query: 620 LRNVERGYFLGSSSDKL 670 L +VER G KL Sbjct: 1320 LTDVERSRSAGGGDSKL 1336 >At3g30842.1 68416.m03968 ABC transporter protein, putative similar to pleiotropic drug resistance like protein [Nicotiana tabacum] GI:20522008, ABC1 protein [Nicotiana plumbaginifolia] GI:14331118; contains Pfam profile PF00005: ABC transporter Length = 1406 Score = 27.5 bits (58), Expect = 8.8 Identities = 15/45 (33%), Positives = 28/45 (62%), Gaps = 2/45 (4%) Frame = +2 Query: 308 DILTQNQQKGWWTIGLINSRYRYLTAETF--GFKINANGTSLKKK 436 +IL++ Q+ +W + YRY+TA+ F GFKI+ G +++ + Sbjct: 429 EILSKKDQEQYWANPEL--PYRYVTAKKFEEGFKIHHFGRAMRSQ 471 >At1g08985.1 68414.m01002 expressed protein Length = 101 Score = 27.5 bits (58), Expect = 8.8 Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Frame = +2 Query: 497 SHLDKY-LAVDSFGNVTCESEEKEPGSKFHISVSDDNSGRWA-LRNVERGYFLG 652 SH +K L D N+ + P + + D+ + W LR +RGYF+G Sbjct: 17 SHDNKLILPRDKVENIVRSTGVPVPRMGIQVEILDNTNSYWVNLRQSQRGYFIG 70 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,836,828 Number of Sequences: 28952 Number of extensions: 263835 Number of successful extensions: 730 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 713 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 730 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1447936096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -