BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10m11 (751 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g01560.1 68418.m00071 lectin protein kinase, putative similar... 34 0.12 At5g01550.1 68418.m00070 lectin protein kinase, putative similar... 33 0.15 At1g60420.1 68414.m06802 DC1 domain-containing protein contains ... 30 1.4 At5g46390.1 68418.m05709 peptidase S41 family protein similar to... 28 7.6 >At5g01560.1 68418.m00071 lectin protein kinase, putative similar to receptor lectin kinase 3 [Arabidopsis thaliana] gi|4100060|gb|AAD00733; contains protein kinase domain, Pfam:PF00069; contains legume lectins alpha and beta domains, Pfam:PF00138 and Pfam:PF00139 Length = 691 Score = 33.9 bits (74), Expect = 0.12 Identities = 18/48 (37%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = +3 Query: 105 KKKTPTLLESISKKISTTETFQRLRNKNLTTLNK-IKYDSELLLHYLY 245 KK TP ++ + + ++ E+ RLR+KNL L K+ ++LLL Y Y Sbjct: 392 KKITPNSMQGVREFVAEIESLGRLRHKNLVNLQGWCKHRNDLLLIYDY 439 >At5g01550.1 68418.m00070 lectin protein kinase, putative similar to receptor lectin kinase 3 [Arabidopsis thaliana] gi|4100060|gb|AAD00733; contains protein kinase domain, Pfam:PF00069; contains legume lectins alpha and beta domains, Pfam:PF00138 and Pfam:PF00139 Length = 688 Score = 33.5 bits (73), Expect = 0.15 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 1/48 (2%) Frame = +3 Query: 105 KKKTPTLLESISKKISTTETFQRLRNKNLTTLNK-IKYDSELLLHYLY 245 KK TP ++ + + I+ E+ RLR+KNL L K ++LLL Y Y Sbjct: 391 KKITPNSMQGVREFIAEIESLGRLRHKNLVNLQGWCKQKNDLLLIYDY 438 >At1g60420.1 68414.m06802 DC1 domain-containing protein contains Pfam domain PF03107: DC1 domain Length = 578 Score = 30.3 bits (65), Expect = 1.4 Identities = 21/62 (33%), Positives = 34/62 (54%) Frame = +3 Query: 90 PLSMSKKKTPTLLESISKKISTTETFQRLRNKNLTTLNKIKYDSELLLHYLYDDQQNKNS 269 P+S + KT LL S++ TE +L + T L + K D E++L L DD+++ N Sbjct: 197 PVSELEGKTIGLLFSVASYRKCTELTPKLV-EFYTKLKENKEDFEIVLISLEDDEESFNQ 255 Query: 270 DY 275 D+ Sbjct: 256 DF 257 >At5g46390.1 68418.m05709 peptidase S41 family protein similar to C-terminal peptidase of the D1 protein [Hordeum vulgare subsp vulgare] GI:1296805; contains Pfam profiles PF03572: Peptidase family S41B, PF00595: PDZ domain (Also known as DHR or GLGF) Length = 428 Score = 27.9 bits (59), Expect = 7.6 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = +3 Query: 357 AQVHVSNGYSFEFHPGSQPRTFQTIHTDG--LIIKVLILCDECCK 485 A++ + G + + G P +T+ +D LI LI+CDE CK Sbjct: 357 AKLFLDEGDTVIYTAGRDPEAQKTVVSDKKPLITAPLIVCDESCK 401 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,646,032 Number of Sequences: 28952 Number of extensions: 187082 Number of successful extensions: 460 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 456 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 460 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1663169840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -