BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10m08 (704 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53271| Best HMM Match : No HMM Matches (HMM E-Value=.) 382 e-106 SB_6632| Best HMM Match : FAD_binding_4 (HMM E-Value=1.70006e-41) 30 1.6 SB_9702| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_49186| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_11242| Best HMM Match : MAM (HMM E-Value=0) 29 4.9 SB_46368| Best HMM Match : DUF156 (HMM E-Value=6.5) 28 6.4 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 SB_20359| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 >SB_53271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 687 Score = 382 bits (940), Expect = e-106 Identities = 170/225 (75%), Positives = 197/225 (87%) Frame = +1 Query: 28 MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNE 207 MARGPKKH+KRLNAPK WMLDKL GV+APRPSTGPHKLRECLPL+IFLRNRLKYAL G E Sbjct: 425 MARGPKKHMKRLNAPKHWMLDKLSGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALNGEE 484 Query: 208 VLKIVKQRLIKVDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAK 387 V KIVKQRLIK+DGKVRTD TYPAGFMDVV+I+KT E FRL+YDVKGRF +HRIT EEAK Sbjct: 485 VKKIVKQRLIKIDGKVRTDTTYPAGFMDVVTIDKTGENFRLLYDVKGRFAVHRITAEEAK 544 Query: 388 YKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNDSIQLDIATTKIMDFIKFESGNL 567 YKL +V+RV G K VPY+VTHD RTIRYPDP IKVND++ +DI T K++D+IKF++GN+ Sbjct: 545 YKLGRVRRVDVGAKGVPYIVTHDARTIRYPDPNIKVNDTVVIDIKTGKVIDYIKFDTGNM 604 Query: 568 CMITGGRNLGRVGTIVSRERHPGSFDIVHIKDSTGHTFATRLNNV 702 M+ GGRN+GRVG + RE+H GSFDIVH+KD+TGH FATRL N+ Sbjct: 605 AMVVGGRNMGRVGMVTHREKHAGSFDIVHVKDATGHQFATRLTNI 649 >SB_6632| Best HMM Match : FAD_binding_4 (HMM E-Value=1.70006e-41) Length = 482 Score = 30.3 bits (65), Expect = 1.6 Identities = 17/72 (23%), Positives = 35/72 (48%) Frame = +1 Query: 358 IHRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNDSIQLDIATTKIM 537 I +TP+ K C+V R++TGP +++ +G + +++ ++ + + + Sbjct: 287 IRMVTPQGTVEKSCQVPRMSTGPDLHHFIMGSEGTLGVITEVTLRIRPVPEIRVYGSVV- 345 Query: 538 DFIKFESGNLCM 573 F FE G CM Sbjct: 346 -FPDFEKGVACM 356 >SB_9702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 708 Score = 29.1 bits (62), Expect = 3.7 Identities = 21/71 (29%), Positives = 31/71 (43%), Gaps = 3/71 (4%) Frame = +3 Query: 468 PLSRPTYQSQRFHPVRHCNYEDYGLHQV*VRELVYDHGRP*LGACGHHRVPR---ETSRL 638 PLS + S R+HP+ C++ + LH L + H + H P ++S L Sbjct: 102 PLSSSSQSSHRYHPL--CHHHHHHLHH--HHHLCHHHLSLFVCLPTQHYFPAFQVQSSPL 157 Query: 639 LRHCAHQGLHG 671 L HC H G Sbjct: 158 LCHCTHDDFSG 168 >SB_49186| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1776 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/56 (19%), Positives = 28/56 (50%) Frame = +1 Query: 184 KYALTGNEVLKIVKQRLIKVDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGR 351 +Y L ++ + + L++ G + P+YP+ ++ ++ +N+LF + R Sbjct: 596 EYWLMASQGQHVSESTLVRGRGDILISPSYPSALLETTTLITSNQLFNTFIESSTR 651 >SB_11242| Best HMM Match : MAM (HMM E-Value=0) Length = 348 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/20 (60%), Positives = 16/20 (80%), Gaps = 2/20 (10%) Frame = +3 Query: 171 EES--SEVCFDRKRSPENCE 224 EES +E+C DRKR P++CE Sbjct: 76 EESRYNELCHDRKRGPDDCE 95 >SB_46368| Best HMM Match : DUF156 (HMM E-Value=6.5) Length = 203 Score = 28.3 bits (60), Expect = 6.4 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = -1 Query: 170 RKITRGKHSRNLWGPVDGLGAYTPPSLSNIHALGAF-KRFKCFLGPRAMLDK 18 RK +R N++G ++GLG+ PP + I F K K F PR K Sbjct: 60 RKRSRSLPRTNVFGTLNGLGSPPPPRDNRIDEYAEFTKSQKSFTFPRRSKQK 111 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.9 bits (59), Expect = 8.5 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 6/45 (13%) Frame = -1 Query: 248 PSTFMRRCFTIFRTSFPVKAYFRRFLRK------ITRGKHSRNLW 132 PS++ F +FRT FP + RF R+ IT ++LW Sbjct: 84 PSSYNGHQFLVFRTDFPFSKHKNRFKRRTKYLYVITTSTKHQHLW 128 >SB_20359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4700 Score = 27.9 bits (59), Expect = 8.5 Identities = 18/79 (22%), Positives = 35/79 (44%), Gaps = 3/79 (3%) Frame = +1 Query: 376 EEAKYKLCKVKRVATGPKNVPYLVTHDG---RTIRYPDPLIKVNDSIQLDIATTKIMDFI 546 E+A +C++ R+ P+ LV G +++ I + Q+ + + + Sbjct: 2971 EDAMQHVCRINRILESPRGNALLVGVGGSGKQSLARLAAFISALEVFQITLRKGYGIPDM 3030 Query: 547 KFESGNLCMITGGRNLGRV 603 K + NLC G +N+G V Sbjct: 3031 KLDLANLCTKAGLKNIGTV 3049 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,252,094 Number of Sequences: 59808 Number of extensions: 574105 Number of successful extensions: 1629 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1481 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1623 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1853669818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -