BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10m02 (712 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014298-2075|AAF48402.1| 646|Drosophila melanogaster CG9509-PA... 29 8.2 AE013599-3450|AAF46891.3| 203|Drosophila melanogaster CG13518-P... 29 8.2 >AE014298-2075|AAF48402.1| 646|Drosophila melanogaster CG9509-PA protein. Length = 646 Score = 28.7 bits (61), Expect = 8.2 Identities = 17/67 (25%), Positives = 29/67 (43%) Frame = +3 Query: 78 YLSLPTARQYKCFKDGNFYWPHNGDNIPDAACRNAYKSVYYKYRALDLESGAAAATAQYM 257 Y + P+ + KDG YWP G + + NA +Y + D + AA + + Sbjct: 126 YFTEPSDEACQAMKDGRCYWP-RGKMLGGSGGVNA--MLYVRGNRRDFDGWAAMGSTGWS 182 Query: 258 FQQYMEY 278 + Q M + Sbjct: 183 YDQVMPF 189 >AE013599-3450|AAF46891.3| 203|Drosophila melanogaster CG13518-PA protein. Length = 203 Score = 28.7 bits (61), Expect = 8.2 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = -3 Query: 134 IKISIFKTFILTGRRQGQIAVRAHCRRVN--HSKQCN**CNHYD 9 ++I I++ R G +AVR HCR + H + + C H D Sbjct: 2 LRIGFVICVIISLRLNGLVAVRVHCRHMERIHEENIHHCCKHQD 45 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 33,317,812 Number of Sequences: 53049 Number of extensions: 766901 Number of successful extensions: 1856 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1812 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1856 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3149551053 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -