BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10m01 (503 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC839.16 |||C-1-tetrahydrofolate synthase|Schizosaccharomyces ... 25 4.9 SPAC3H5.10 |rpl3202|rpl32-2, rpl32|60S ribosomal protein L32|Sch... 25 8.5 >SPBC839.16 |||C-1-tetrahydrofolate synthase|Schizosaccharomyces pombe|chr 2|||Manual Length = 937 Score = 25.4 bits (53), Expect = 4.9 Identities = 20/59 (33%), Positives = 30/59 (50%) Frame = +3 Query: 69 KVNAIIRKMANTSDITPDIVVSAQINSGDEGVLHFIIEDEYYLKKRGVGAHIIKVASSP 245 K NA + + ++ DIV +A I G+ HF+ D +LKK GV A + + S P Sbjct: 183 KANATVTLCHSKTESIADIVRTADIVVAAIGIPHFVKAD--WLKK-GVVAIDVGINSIP 238 >SPAC3H5.10 |rpl3202|rpl32-2, rpl32|60S ribosomal protein L32|Schizosaccharomyces pombe|chr 1|||Manual Length = 127 Score = 24.6 bits (51), Expect = 8.5 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +3 Query: 192 YLKKRGVGAHIIKVASSPXLXLLYKNAYSAVSCGNYS 302 Y G+ A +++ S L L++ Y+A GN S Sbjct: 62 YCMPNGLKAFLVRNVSDVELLLMHNKTYAAEIAGNVS 98 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,786,369 Number of Sequences: 5004 Number of extensions: 31874 Number of successful extensions: 84 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 84 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 84 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 200198394 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -