BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10m01 (503 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0319 - 2148788-2148892,2149474-2149557,2149643-2149723,215... 34 0.056 05_01_0205 + 1475628-1475969,1477446-1477642,1478476-1478611,147... 30 1.2 >02_01_0319 - 2148788-2148892,2149474-2149557,2149643-2149723, 2150303-2150480,2150811-2150954,2151048-2151094, 2151353-2151409,2151566-2151664,2151867-2151989, 2152083-2152205,2152594-2152707,2152972-2153160, 2153412-2153578,2153904-2153988,2155431-2155628, 2155978-2156175 Length = 663 Score = 34.3 bits (75), Expect = 0.056 Identities = 26/101 (25%), Positives = 47/101 (46%), Gaps = 8/101 (7%) Frame = +3 Query: 87 RKMANTSDITP--DIVVSAQINSGDEGVLHFIIEDEYYLKKRGVGAHIIKVASSPXLXLL 260 R N+S I D ++S Q+N+G G H E + Y+ +G AH++ A + L L+ Sbjct: 539 RTYENSSSIRKACDFILSKQLNTGGWGESHVSNETKVYVNIKGDRAHVVNTAWA-MLTLI 597 Query: 261 YKNAY----SAVSCGNYSILCNLVQNGEY--DLNAXMFNCA 365 Y + + C ++ ++ GE+ + FNC+ Sbjct: 598 YAGQMERDPTPLHCAAKELINMQLETGEFPQQEHVGCFNCS 638 >05_01_0205 + 1475628-1475969,1477446-1477642,1478476-1478611, 1478706-1479178,1479287-1479404,1479762-1479911, 1480039-1480125,1480536-1480829 Length = 598 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +3 Query: 417 PDNNKTDAAVNTSSPKRAVETENDDDXDE 503 PD K V+T PK ++T+ND D DE Sbjct: 249 PDELKGKIIVSTKPPKEYLQTKNDADADE 277 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,430,394 Number of Sequences: 37544 Number of extensions: 200505 Number of successful extensions: 463 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 456 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 463 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1071221400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -